| Sequel |
| SEQUEL livestyle - the home page |
| http://www.sequel.de |
| Neben der Geschichte der Münchner Folkband und der Diskographie werden ein Tagebuch, Konzerttermine, eine Galerie und ein Bandshop angeboten. |
| |
| |
| browser, unterst, sequel, livestyle |
| (SLD : sequel.de) |
| World/Deutsch/Kultur/Musik/Genres/Musik_anderer_Kulturen/Folk/Musiker |
| zum Seitenanfang ↑ |
| Batman Sequel Taken Over By Joker? |
| Batman Sequel Taken Over By Joker? |
| http://www.cinemablend.com/new/Batman-Sequel-Taken-Over-By-Joker-2949.html |
| Wouldn’t that be a really unique way to approach a Batman Begins sequel? Make Joker the star, and Ba tman an ancillary figure stalking and haunting him? By Josh Tyler. |
| Batman Sequel Taken Over By Joker? - Movies News |
| Batman Sequel Taken Over By Joker?, movie news |
| undefined, typeof, office, interviews, theatrical, recaps, previews, gossip, photos, reviews, traile rs, document, batman, sequel, 1237708, urchintracker, images, 10000000000000000, random, gettrigger, posters |
cinemablend.com - rank der domain 8002 (3051 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| sequel |
|
|
| sequel |
| zum Seitenanfang ↑ |
| Sequel |
| SEQUEL - THE BEST BAND IN TAMPA BAY!! |
| http://www.sequelband.net/ |
| Cover band from Tampa Bay, Florida, with over 15 years of experience. History, song list, and schedu le. |
| |
| |
| georgia, sequel, number, sequel, pictures, contact, myspace |
| (SLD : sequelband.net) |
| Arts/Music/Bands_and_Artists/Cover_Bands/S |
| zum Seitenanfang ↑ |
| Sequel |
| Sequel |
| http://www.rawos.com/odbc/ |
| An object-oriented wrapper for ODBC implementation for Win32 platforms. |
| |
| sequel, sql, db, database, odbc, oracle, access, sql, server, asp, active, pages, vb, script, vb scr ipt, delphi, pascal, builder, c, c++, basic, visual, databases, interface, com, automation, paradox, fox, pro, unicode, free, array, parameter |
| support, please, browser, sequel, frames |
| (SLD : rawos.com) |
| Computers/Programming/Component_Frameworks/COM/Components/Database |
| zum Seitenanfang ↑ |
| sequel |
|
|
| sequel |
| zum Seitenanfang ↑ |
| Sequel |
| |
| http://www.sequel.pl |
| Oferuje dedykowane systemy do zarządzania jakością, projektami oraz wiedzą oparte na platformie i te chnologii Lotus Domino, jak również na technologiach Open Source. |
| |
| |
| system, projektowanie, systemy, sequel, informatyczne |
| (SLD : sequel.pl) |
| World/Polski/Komputery/Oprogramowanie/Biznesowe |
| zum Seitenanfang ↑ |
| Movie Forums - Shrek 2 |
| Shrek 2 A Worthy Sequel :: Movie Forums |
| http://www.movieforums.com/reviews/shrek_2.html |
| Review of the film by Chris Bowyer. |
| A review of Shrek 2 A Worthy Sequel on Movie Forums |
| Shrek 2 A Worthy Sequel,Shrek 2 A Worthy Sequel review,Shrek 2 A Worthy Sequel movie,Shrek 2 A Worth y Sequel forum,movie forums,movie forum,movie reviews,movies,movie board,movie discussion,chat,movie awards |
| breadcrumb, forums, center, function, counter, bgcolor, weight, visited, quizzes, friday, c1c1c1, of fice, padding, reviews, dadada, family, verdana, normal, images, sequel, worthy, 666666, margin, bot tom |
movieforums.com - rank der domain 247093 (95358 in US)
|
| Arts/Animation/Movies/Titles/Shrek_Series/Shrek_2 |
| zum Seitenanfang ↑ |
| GameSpot Review (PC) |
| Riven: The Sequel to Myst for PC - GameSpot |
| http://www.gamespot.com/pc/adventure/riventhesequeltomyst/ |
| Rated 7.8/10 by Jeff Sengstack. "It's a leisurely paced, all-encompassing, mentally challenging expe rience. If you enjoyed Myst, you'll thoroughly enjoy Riven." Reader reviews. 5 screen shots. |
| Riven: The Sequel to Myst for PC - GameSpot offers reviews, previews, cheats, and more. Count on us for all of the latest on the Riven: The Sequel to Myst Computer Game. |
| Riven: The Sequel to Myst for PC, Riven: The Sequel to Myst PC Game, Riven: The Sequel to Myst Compu ter Game, PC Riven: The Sequel to Myst, Riven: The Sequel to Myst Video Game, Riven: The Sequel to M yst Reviews, Riven: The Sequel to Myst Previews, Riven: The Sequel to Myst Pictures |
| imgelem, document, return, itrkid, getelementbyid, gamespot, sequel, parentelem, review, images, fea tures, composers, rbxcprefixed, desturi, ctrkprefix, function, netxp1, itrkuri, newuri, parentid, en joyed, faction, showcase, studio, thoroughly, challenging, armageddon, discuss, domain, gamespot, qu estion, mentally, encompassing, leisurely, experience, search, behind, latest, greatest, download, m artin, industry, series, interview, donnell, online, quality, download, encodeuricomponent, uphelpfo rgot, password |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Myst_Series/Riven/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot Review |
| Riven: The Sequel to Myst Review for PC - GameSpot |
| http://www.gamespot.com/pc/adventure/riventhesequeltomyst/review.html |
| Rated 5.5/10. "Playing Riven on the PlayStation is sort of like watching Star Wars on a 13" TV; you' ll get the point but you're definitely missing something." By John Broady. Reader reviews. 5 screen shots. |
| It's a leisurely paced, all-encompassing, mentally challenging experience. If you enjoyed Myst, you' ll thoroughly enjoy Riven. |
| Riven: The Sequel to Myst Review for PC, PC Riven: The Sequel to Myst Review, Riven: The Sequel to M yst Review, PC Riven: The Sequel to Myst, Riven: The Sequel to Myst for PC, Riven: The Sequel to Mys t Article, Riven: The Sequel to Myst Hands On |
| imgelem, document, gamespot, function, return, reviews, review, sequel, script, player, getelementby id, location, adventure, itrkid, cheats, puzzles, through, system, facebook, experience, connect, an dreas, parentelem, islands, played, interactive, articles, moneywatch, metacritic, maxpreps, movieto me, search, mysimon, graphics, cbssports, cbsnews, cbsinteractive, storyline, plenty, looked, animat ions, require, beyond, unique, universe, father, critic, scores, sports, college, content |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Myst_Series/Riven/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Sequel |
| Sequel :: A Maelin Starpyre EQ Guild - Home |
| http://www.sequelguild.com/ |
| Includes news, membership roster, DKP/ELP listing, forums and recruitment information. |
| sequel, everquest |
| sequel, everquest |
| sequel, people, started, server, gallery, defeated, plugins, function, account, comments, access, co mments, maelin, events, ratblasterpublished, document, august, addcss, loadimage, guilds, jscript, d ragon, originally, together, decided, getimage, underfoot, donuld, imageindex, raiding, original, ki ckout, oldest, created, joined, veterans, content, expansions, strats, screenshots, around, awesome, palladium, forgot, business, unfinished, ranger, brothers, endgame, became, donations |
sequelguild.com - rank der domain 952432 (332414 in US)
|
| Games/Video_Games/Roleplaying/Massive_Multiplayer_Online/EverQuest_Games/EverQuest/Clans_and_Guilds/Maelin_Starpyre |
| zum Seitenanfang ↑ |
| What happened to the sequel to "Zebulon"? |
| What happened to the sequel to "Zebulon"? |
| http://www.df.lth.se/~mol/owngames/zebsequel.html |
| The author hasn't written it and probably never will. |
| |
| |
| sequel, zebulon, written, finished, mistake, happened, lesson, announce, receive, people, disappoint , asking, adventure, nearly, mentioned, stupid, pretty, already, existed, something, intriguing, rat her, probably, either, fruitful, happens, because |
lth.se - rank der domain 138412 (629 in SE)
|
|
| zum Seitenanfang ↑ |
| Batman Begins Sequel Gets a Name? |
| Batman Begins Sequel Gets a Name? - Cinematical |
| http://www.cinematical.com/2006/07/10/batman-begins-sequel-gets-a-name/ |
| This is probably nothing to get concerned about but it is certainly interesting. And it might turn o ut to be something. By Mark Beall. |
| This is probably nothing to get concerned about -- but it is certainly interesting. And it might tur n out to be something, so we're going |
| |
| commentid, function, batman, document, getelementbyid, cinematical, engadget, cinematical, inception , autoblog, return, adsonar, sequel, joystiq, comments, comment, interview, original, christopher, r eplytoundo, begins, addthis, replytotext, chinese, japanese, another, children, villain, replyind, n etwork, innerhtml, jackson, office, sorcerer, movies, tweets, postid, cinematographer, director, get url, clayface, speculation, something, images, sequel, nothing, called, interesting, friday, crisis, rumormonger |
cinematical.com - rank der domain 980810 (414462 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| Gerard Butler To Star In Phantom Sequel? |
| Gerard Butler To Star In Phantom Sequel?. - Female First |
| http://www.femalefirst.co.uk/entertainment/Gerard+Butler-52459.html |
| Scottish actor Gerard Butler is the favourite to star in the West End sequel to The Phantom Of The O pera. |
| |
| Gerard Butler, The Phantom Of The Opera |
| jquery, butler, phantom, gerard, sequel, sequel, function, webber, pagetracker, andrew, visibility, female, theatre, coming, famous, reprise, forthcoming, express, impresario, newspaper, british, ever ything, believes, another, reveals, because, helped, career, original, massive, audience, source, no vember, called, another, although, contender, project, involvement, confirmed, favourite, forumdiscu ssion, boardquick, chatuser, search, magazineblogdiscussion, boardshoppingdating, custom, blogsshopp inglingerieswimwearbooksmusicdvdsgamesgift, ideascelebritiescelebrity, beautyparentingmotoringtravel food |
femalefirst.co.uk - rank der domain 20628 (532 in GB)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| JustJared: Gerard Butler To Star in Phantom Sequel? |
| Gerard Butler To Star in Phantom Sequel? | Gerard Butler : Just Jared |
| http://justjared.buzznet.com/2008/06/05/gerard-butler-phantom-of-the-opera-sequel/ |
| Andrew Lloyd Webber wants to bring Gerry to the London stage as the Phantom, a role he played in the 2004 film. Includes photo gallery. |
| Gerard Butler To Star in Phantom Sequel? |
| Gerard Butler, celebrity, celebs, pictures, photos, paparazzi, gossip |
| butler, gerard, document, function, phantom, justjared, sequel, window, limitfield, script, geteleme ntbyid, limitnum, celebs, javascript, disaster, script, because, crawford, createelement, position, permalink, bmquery, siteidentifier, miller, appendchild, another, michael, singing, sequel, brightma n, personal, jennifer, should, better, people, someone, network, bikini, 0first, lindsay, archive, o nload, version, sienna, setattribute, height, location, ckrating, robert, pattinson, andrew |
buzznet.com - rank der domain 8017 (3065 in US)
|
| Arts/Performing_Arts/Acting/Actors_and_Actresses/B/Butler,_Gerard/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| JustJared: Gerard Butler To Star in Phantom Sequel? |
| Gerard Butler To Star in Phantom Sequel? | Gerard Butler : Just Jared |
| http://justjared.buzznet.com/2008/06/05/gerard-butler-phantom-of-the-opera-sequel/ |
| Andrew Lloyd Webber wants to bring Gerry to the London stage as the Phantom, a role he played in the 2004 film. Includes photo gallery. |
| Gerard Butler To Star in Phantom Sequel? |
| Gerard Butler, celebrity, celebs, pictures, photos, paparazzi, gossip |
| butler, gerard, document, function, phantom, justjared, sequel, limitfield, window, london, geteleme ntbyid, because, celebs, crawford, disaster, createelement, script, siteidentifier, limitnum, permal ink, script, position, miller, javascript, bmquery, version, network, sequel, andrew, singing, 0firs t, ckrating, brightman, appendchild, should, onload, another, better, someone, location, sienna, per sonal, people, pattinson, robert, loadchartbeat, buzznet, rachel, archive, jennifer, gettime |
buzznet.com - rank der domain 8017 (3065 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| Epinions.com (PlayStation version) |
| Riven: The Sequel To Myst for PlayStation 1 Product Reviews and Price Comparison - Epinions.com |
| http://www.epinions.com/game-Software-All-Playstation-Riven |
| Player ratings of "Riven: The Sequel to Myst" for the Sony PlayStation. |
| Epinions.com - Compare prices on Riven: The Sequel To Myst for PlayStation 1 - PlayStation 1 Games. Compare prices from across the web and read product reviews on Riven: The Sequel To Myst for PlaySta tion 1 |
| Riven: The Sequel To Myst for PlayStation 1, reviews, product reviews, consumer reviews |
| background, openwindow, images, selected, document, padding, playstation, sequel, triggerparms, acti ve, epinions, repeat, margin, taxbox, reviews, window, rating, border, visited, bottom, corner, posi tion, inactive, decoration, reviews, weight, product, epinions, product, playstation, bybase, sealed , bystore, shipping, review, subscribe, comparison, compare, preloadpopupimages, details, prices, de ceptively, delicate, trusted, customer, island, returned, lowest, unravel, mystery, father |
epinions.com - rank der domain 2990 (1153 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Myst_Series/Riven/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Sequel Venture Partners |
| Sequel Venture Partners : Venture Capital |
| http://www.sequelvc.com/ |
| Investment focus: early-stage technology-based companies in the Rocky Mountain region. |
| |
| |
| sequel, venture, internet, colorado, boulder, partners, services, arapahoe, technology, avenue, capi tal, funding, venture, capital, provides, technology, specializes, healthcare, million, businesses, manages, enterprise |
| (SLD : sequelvc.com) |
| Business/Financial_Services/Venture_Capital/Regional/North_America/United_States |
| zum Seitenanfang ↑ |
| Sequel Solutions |
| SEQUEL SOLUTIONS - Oracle Spatial Services - SQLWord - Integration Oracle Microsoft Word |
| http://www.sequel.nl/ |
| SQLWord, export Microsoft Word documents from Oracle. |
| Sequel Solutions - Oracle Spatial Services - SQLWord - Integration Oracle Microsoft Word |
| Oracle, Oracle9i, Oracle8i, RDBMS, database, SQL, query, PL/SQL, mail-merge, merge, word, mail, Micr osoft, Microsoft Word, Integration, Reporting, Spatial, GIS, ESRI, GeoMedia, MapGuide, Designer, For ms, consultancy, webdesign, XSL, XSLT |
| oracle, integration, microsoft, sqlword, spatial, sequel, solutions, services |
| (SLD : sequel.nl) |
| Computers/Software/Databases/Oracle/Tools |
| zum Seitenanfang ↑ |
| Playbill News: Phantom Sequel Aiming for November 2009 Bow in London |
| Phantom Sequel Aiming for November 2009 Bow in London - Playbill.com |
| http://www.playbill.com/news/article/118218.html |
| A Lloyd Webber spokesperson told Playbill.com that American lyricist, and 2008 Tony nominee, Glenn S later is now working on words to Lloyd Webber's music for the sequel to the smash international hit. By Andrew Gans and Kenneth Jones. |
| The sequel to Andrew Lloyd Webber's The Phantom of the Opera is aiming for a bow in London's West En d in November 2009. |
| Phantom Sequel Aiming for November 2009 Bow in London, Phantom, Andrew Gans |
| phantom, webber, playbill, sequel, thefield, addthis, andrew, broadway, christine, london, november, composer, working, prince, musical, features, little, mermaid, manhattan, wainwright, promises, uto pia, toppers, island, header, travels, entries, campus, castle, aiming, robert, sequel, theatre, rec ording, shannon, celebrated, called, dynamic, dynamicdrive, 000000, mouseovertabsmenu, kenneth, cont ainer, another, slater, folles, copyright, webmaster, comments, privacy, policy |
playbill.com - rank der domain 16531 (6130 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| The Omega Stone: The Sequel To Riddle Of The Sphinx |
| The Omega Stone: The Sequel To Riddle Of The Sphinx |
| http://www.theomegastone.com/ |
| Official site offers a demo, game patches, screenshots, and various downloads. |
| This CD-ROM adventure game picks up where "Riddle of the Sphinx" left off. Explore some of the most mysterious places on earth |
| Omni Creative Group, CD-ROM, PC Gaming, Gaming, Adventure, Adventure Games, Adventure Game, CD-ROM A dventure Game, Easter Island, Moi, Moi of Easter Island, Chitzen Itza, Mayan, Mayan Ruins, Codices, Yucatan, Yucatan Pennisula, Exotic, Jungle, Yucatan Jungle, Stonehenge, megalith, Bermuda Triangle, Devil's Triangle, shipwreck, Road to Biminy, Atlantis, Lost City, Ancient Civilizations, Ancient Civ ilizations, Omega, Omega Stone, The Omega Stone, ROTS Sequel, Riddle of the Sphinx Sequel, Sequel to Riddle of the Sphinx, ROTS |
| sphinx, riddle, sequel |
| (SLD : theomegastone.com) |
| Games/Video_Games/Adventure/Graphical_Adventures/Riddle_of_the_Sphinx_Series/Omega_Stone_-_Riddle_of_the_Sphinx_II,_The |
| zum Seitenanfang ↑ |
| "V for Vendetta" Sequel Planned |
| Dark Horizons | News | V for Vendetta Sequel Planned - April 1st 2006 |
| http://www.darkhorizons.com/news06/060401b.php |
| Warner Brothers Pictures has decided to move forward with plans for a sequel that takes even riskier steps. |
| |
| |
| shorts, horizons, archive, lantern, office, reviews, ratings, interviews, schedule, function, advert isements, torchwood, pilgrim, showtime, ribbed, guests, action, portman, vendetta, though, master, s hadows, breaking, pleasure, remake, volume, osterman, latest, trailers, priest, photos, predators, s chwentke, rodriguez, strong, ruffalo, america, sequel, converted, series, captain, holloway, terrori sts, heartbeat, carnage, mcquarrie, travelling, oyelowo, felton, streep, article |
darkhorizons.com - rank der domain 31370 (11714 in US)
|
| Arts/Movies/Titles/V/V_for_Vendetta/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| Sequel S.r.l. |
| Sequel Srl - Multimedia Internet Web Design CD-Rom |
| http://www.sequel.it |
| [Milano] Illustra i servizi dell'azienda: creazione siti internet, presentazioni aziendali, masteriz zazione e personalizzazione CD-Rom, stampe e cartelloni. |
| multimedia internet web design CD-Rom interattivi siti internet web grafica CD dominio Milano duplic azione masterizzazione masterizzare |
| multimedia internet web design CD-Rom siti internet web grafica CD dominio Milano duplicazione maste rizzazione |
| design, internet, sequel, multimedia |
| (SLD : sequel.it) |
| World/Italiano/Affari/Information_Technology/Multimedia |
| zum Seitenanfang ↑ |
| Heath Ledger as The Joker in Batman Begins Sequel |
| Heath Ledger as The Joker in Batman Begins sequel - /FILM |
| http://www.slashfilm.com/article.php/20060721001534202 |
| This has not yet been confirmed by the studio, but every news outlet is reporting this casting rumor as truth. |
| |
| |
| batman, sequel, typeof, ledger, undefined, begins, 10000000000000000, random, document, important, a ctors, search, departed, christopher, potter, sciretta, include, confirmed, rumored, number, academy , screenwriter, enlists, titles, follow, bringing, killing, gordon, process, scarring, sequel, carel l, williams, bettany, contention, chrispin, gyllenhaal, glover, competent, overall, choices, obvious , something, choice, thought, oldman, provided, mountain, brokeback, performance, feedburner |
slashfilm.com - rank der domain 7559 (2889 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| Film School Rejects: Gerard Butler Denies Involvement in the 300 Sequel |
| Gerard Butler Denies Involvement in the 300 Sequel | Film School Rejects |
| http://www.filmschoolrejects.com/news/gerard-butler-for-300-sequel-no.php |
| While sitting in the press conference for Guy Ritchie's hopefully triumphant return into manhood, Ro cknRolla, Gerard Butler was asked about his possible involvement in the sequel/prequel for 300. By B rian C. Gibson. |
| While sitting in the press conference for Guy Ritchie's hopefully triumphant return into manhood, Ro cknRolla, Gerard Butler was asked about his possible involvment in the sequel/prequel for 300. |
| 300,comic-con 2008,gerard butler,guy ritchie,rocknrolla,watchmen,zack snyder,in development,movie ne ws |
| document, typeof, undefined, function, trailer, comment, inception, filmschoolrejects, butler, disqu s, siteanalytics, sequel, 10000000000000000, getelementsbytagname, javascript, random, createelement , window, snyder, gerard, butler, appendchild, height, script, gerard, rejects, return, features, re cent, protocol, location, reviews, onload, setattribute, loadchartbeat, development, sequel, contrib utors, comments, involvement, interview, school, seeing, really, robert, f80251, f80249, article, st atic, comedy, policy |
filmschoolrejects.com - rank der domain 30839 (11363 in US)
|
| Arts/Performing_Arts/Acting/Actors_and_Actresses/B/Butler,_Gerard/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| TeenHollywood.com: Bale Dreads Filming Batman Sequel In The Summer Heat |
| Bale Dreads Filming Batman Sequel In The Summer Heat - TeenHollywood.com |
| http://www.teenhollywood.com/d/151170/1055/bale-dreads-filming-batman-sequel-in-the-summer-heat.html |
| Actor Christian Bale is dreading filming the sequel to Batman Begins this summer because he knows ho t weather and rubber suits are a bad combination. |
| Actor Christian Bale is dreading filming the sequel to Batman Begins this summer - because he knows hot weather and rubber suits are a bad combination. |
| |
| undefined, typeof, random, document, batman, 10000000000000000, filming, dreads, contests, rubber, m ovies, pictures, filming, summer, f323020, f315194, teenhollywood, default, comments, sequel, luckil y, follow, prefers, however, summertime, really, looking, forward, wearing, through, chicago, policy , privacy, contact, copyright, static, insert, content, courtesy, thetvdb, comments, loading, operat ion, minimal, covert, people, actually, comment, comment, seeing, wallpapers |
teenhollywood.com - rank der domain 56379 (21430 in US)
|
| Arts/Performing_Arts/Acting/Actors_and_Actresses/B/Bale,_Christian/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| Batman Begins Sequel Title and Casting Confirmed |
| Batman Begins sequel Title and Casting confirmed - /FILM |
| http://www.slashfilm.com/article.php/20060731185318659 |
| Heath Ledger has indeed signed on to play The Joker in the film's sequel, The Dark Knight. |
| |
| |
| batman, begins, undefined, typeof, knight, christopher, christian, ledger, warner, starring, recentl y, document, direct, casting, random, important, search, sequel, 10000000000000000, sciretta, steven , spielberg, number, departed, brothers, before, robinov, production, pictures, penguin, credits, in clude, signed, gotham, character, potter, little, casting, confirmed, academy, american, golden, cri tics, window, memento, toolbar, groundbreaking, attention, garnered, chronicled, resizable |
slashfilm.com - rank der domain 7559 (2889 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| Playbill News: Lloyd Webber Premieres Phantom Sequel at Sydmonton |
| Lloyd Webber Premieres Phantom Sequel at Sydmonton - Playbill.com |
| http://www.playbill.com/news/article/119528.html |
| Lord Andrew Lloyd Webber presented the first act of his sequel to The Phantom of the Opera, entitled Phantom: Once Upon Another Time, at his annual Sydmonton Festival earlier this month. By Andrew Gan s. |
| Lord Andrew Lloyd Webber presented the first act of his sequel to The Phantom of the Opera, entitled Phantom: Once Upon Another Time, at his annual Sydmonton Festival earlier this month. |
| Lloyd Webber Premieres Phantom Sequel at Sydmonton, Phantom, Andrew Gans |
| thefield, webber, phantom, sydmonton, andrew, container, mouseovertabsmenu, christine, dynamic, anot her, dynamicdrive, sequel, premieres, musical, playbill, having, running, island, london, directed, outside, located, describes, estate, meanwhile, mysterious, impresario, paying, fortune, accepted, a musement, employer, curtain, squandered, automaton, crawls, become, famous, because, husband, fallen , singer, search, classname, improved, function, clearsearch, 000000, listings, features, advanced |
playbill.com - rank der domain 16531 (6130 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| ComingSoon.net: Shoot 'Em Up Sequel Script Already Done |
| Shoot 'Em Up Sequel Script Already Done - ComingSoon.net |
| http://www.comingsoon.net/news/movienews.php?id=20891 |
| Although New Line Cinema's hard core action flick Shoot 'Em Up won't hit theaters until September 7, director Michael Davis said today he was prepared to make a sequel. By Heather Newgen. |
| |
| |
| undefined, typeof, document, 10000000000000000, random, inception, release, triggered, office, lengt h, return, reviews, dreams, nameeq, craveonline, transformers, lautner, wanted, singer, debuts, impo ssible, mission, avatar, special, edition, gordon, eisner, prequel, spartacus, felton, potter, subst ring, return, chicago, comments, undercover, angelina, releases, features, warrior, weekend, product ion, stills, movies, 230x90, object, michael, sequel, database, report, already |
comingsoon.net - rank der domain 4076 (1544 in US)
|
|
| zum Seitenanfang ↑ |
| The Stage: Phantom Sequel Set for November 2009 Opening |
| The Stage / News / Phantom sequel set for November 2009 opening |
| http://www.thestage.co.uk/news/newsstory.php/20854/phantom-sequel-set-for-november-2009-opening |
| Andrew Lloyd Webber's sequel to the Phantom of the Opera is being lined up to open in November of ne xt year, the composer has revealed. By Alistair Smith. |
| Andrew Lloyd Webber's sequel to the Phantom of the Opera is being lined up to open in November of next year, the composer has revealed. |
| theatre, auditions, stage, the stage, newspaper, plays, actors, reviews, productions, musicals, regi onal theatre, west end, television, tv, radio, broadcasting |
| phantom, 5209000220661028, googleaddslot, sequel, webber, document, 300x250, googlefillslot, addvari able, november, version, whether, addthis, another, awards, talent, search, compact, safari, archive , waterloo, children, railway, anything, channel, culture, theatre, another, patron, national, onlin e, topleft, opening, gajshost, 215x90, 120x600, getelementbyid, content, function, 728x90, protocol, script, pagetracker, location, andrew, bottom, ceremony, hosting, contact, created, edition |
thestage.co.uk - rank der domain 152110 (4452 in GB)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| BBC News - Half-Life Sequel Ups the Ante |
| BBC NEWS | Technology | Half-Life sequel ups the ante |
| http://news.bbc.co.uk/2/hi/technology/3199545.stm |
| The sequel to hugely popular Half-Life computer game is going to be worth the five-year wait, say it s makers. |
| The sequel to hugely popular Half-Life computer game is going to be worth the five-year wait, say it s makers. |
| BBC, News, BBC News, news online, world, uk, international, foreign, british, online, service |
| lombardi, player, wanted, sequel, counter, strike, popular, september, shared, people, different, or iginal, technology, graphics, pacific, ground, confident, giving, africa, import, americas, gamers, environment, strong, stories, millions, pushing, barrels, console, rumours, recent, london, awards, action, dreams, europe, entertainment, happens, shooter, friend, printable, science, create, working , physically, simulates, pictures, programmes, country, profiles, related |
bbc.co.uk - rank der domain 49 (1 in GB)
|
| Games/Video_Games/Shooter/H/Half-Life_Series/Half-Life_2/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Sequel Corporation |
| anodizingracks.com... your best source for anodizing racks, discs and clips. |
| http://www.anodizingracks.com |
| Manufacturer of aluminum anodizing racks, provides online catalog and rack specifications. |
| Your source for anodizing racks, discs and clips. |
| Sequel Corporation, Sequel, anodizing, aluminum anodizing racks, anodizing racks, aluminum finishing , rack, racks, jig, jigs, aluminum, aluminium, titanium, titanium anodizing racks, box rack, pin rac ks, disc rack, disk rack, clips |
| shipping, ground, anodizing, sequel, please, extensive, forward, quality, provide, products, fashion , timely, continuing, manufactures, customer, current, sincerely, business, collars, easier, anodizi ngracks, source, ordering, orders, corporation |
| (SLD : anodizingracks.com) |
| Business/Industrial_Goods_and_Services/Machinery_and_Tools/Plating,_Polishing_Equipment |
| zum Seitenanfang ↑ |
| FILM - Robin Williams Wants to be The Joker in Batman Begins Sequel |
| Robin Williams Wants to be The Joker in Batman Begins sequel - /FILM |
| http://www.slashfilm.com/article.php/20060411113429747 |
| The Batman Begins sequel doesn't even have a finished script, yet not a week goes by that we don't h ear another Joker caster rumor. By Jon Christensen. |
| |
| |
| williams, undefined, typeof, batman, begins, random, sequel, 10000000000000000, document, important, search, sciretta, potter, number, departed, powered, viewed, firefox, interview, design, caster, br owntoad, recent, latinoreview, customized, mediatemple, worked, owners, director, insomnia, intervie wer, respective, transitional, another, christopher, mentions, scirettafiled, copyrights, posted, tu esday, casting, copyright, policy, privacy, trademarks, finished, script, taking, willams, feedburne r, provided |
slashfilm.com - rank der domain 7559 (2889 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| 'Batman' Sequel News: 'Dark Knight' Casts Its Joker |
|
| http://www.zap2it.com/movies/news/zap-darkknightledgercasting,0,1962038.story |
| In a flurry of Monday night news, Warner Brothers officially announced the name of its "Batman Begin s" sequel, as well as the casting for the film's new villain. |
| |
| |
| |
zap2it.com - rank der domain 1285 (540 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| CocoaMySQL |
| CocoaMySQL - A MySQL GUI for Mac OS X |
| http://cocoamysql.sourceforge.net/ |
| A MySQL GUI for Mac OS X. |
| |
| |
| project, create, called, sequel, sequel, google, source, cocoamysql, abandoned |
sourceforge.net - rank der domain 156 (74 in US)
|
| Computers/Software/Operating_Systems/Mac_OS/Open_Source/Internet |
| zum Seitenanfang ↑ |
| First Act of 'Phantom' Sequel to Have Private Reading |
| First Act of 'Phantom' Sequel to Have Private Reading 2008/06/23 |
| http://broadwayworld.com/viewcolumn.cfm?colid=29189 |
| The first act of the new musical sequel to Phantom of the Opera, Phantom: Once Upon Another Time, is about to be performed privately for friends of Andrew Lloyd Webber. |
| The first act of the new musical sequel to Phantom of the Opera, "Phantom: Once Upon Another Ti me" is about to be performed privately for friends of Andrew Lloyd Webber. |
| First Act of 'Phantom' Sequel to Have Private Reading, Broadway |
| height, background, decoration, florida, california, document, tickets, padding, theatre, tickets, f unction, border, position, jquery, family, margin, broadway, 5985687329815214, 999999, absolute, car olina, presents, arizona, wisconsin, ffffff, jersey, articles, broadwayworld, googleaddslot, ffe92f, google, fieldset, location, visited, helvetica, indiana, verdana, memphis, c5c5c5, phantom, washing ton, musical, virginia, oklahoma, decoration, bottom, window, yellow, reading, underline, newicons |
broadwayworld.com - rank der domain 18205 (6872 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| Weatherbury Farm |
| Index |
| http://members.multimania.co.uk/patmann/index.html |
| Information about Thomas Hardy and Dorset, and the sequel to Far From the Madding Crowd. |
| |
| |
| bathsheba, children, published, xlibris, family, amazon, gabriel, comments, pagetracker, victorian, analytics, google, 7539432, guestbook, patricia, gajshost, dolling, sequel, weatherbury, document, m adding, corporation, father, martinsham, yourself, stunning, countryside, urbervilles, review, urber ville, interested, sequel, boscastle, writers, booksellers, budmouth, inheritance, stourcastle, king sbere, available, paperback, casterbridge, godwin, created, protocol, location, height, unescape, 3c script, script, gettracker |
multimania.co.uk - rank der domain 52322 (20208 in US)
|
| Arts/Literature/Authors/H/Hardy,_Thomas |
| zum Seitenanfang ↑ |
| Lloyd Webber Names Phantom Sequel? With Barrowman??? |
| |
| http://www.whatsonstage.com/index.php?pg=207&story=E8821213096084 |
| John Barrowman, a judge on all three Lloyd Webber TV competitions to date, is rumored to up for the role of the famous masked man in the sequel. |
| |
| |
| whatsonstage |
whatsonstage.com - rank der domain 99386 (2727 in GB)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| Game Revolution Review (Mac) |
| Riven: The Sequel to Myst Review for the MAC |
| http://www.gamerevolution.com/oldsite/games/mac/riven.htm |
| Rated A by Thomas Garcia. "This game is a masterpiece and is worth every single penny." |
| An honest, unbiased review of Riven: The Sequel to Myst for the MAC |
| video games, video, game, reviews, cheats, downloads, previews, videos, community, forums,reviews, a rticles,Riven: The Sequel to Myst, Mac |
| undefined, typeof, document, random, 10000000000000000, around, cheats, sequel, better, walking, sim ply, excellent, island, definitely, puzzle, graphics, adventure, really, videos, because, soccer, de tails, property, puzzles, landscapes, anything, played, protocol, itself, challenging, information, supposed, location, function, script, gibson, sounds, f315632, manager, cycling, little, putting, f3 04726, thriller, 2328145, default, 6036161, nintendo, f311171, beacon, cheats |
gamerevolution.com - rank der domain 17731 (6524 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Myst_Series/Riven/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Sequel's Sandbox |
| PowerBuilder Developers' Resource - Sequel's Sandbox |
| http://www.techno-kitten.com |
| Information and tools for PowerBuilder developers. Includes PBL Peeper, an essential toolbox. |
| |
| |
| powerbuilder, sandbox, sequel, document, breastcancer, rainforest, sandbox, hungersite, dreams, kitt en, linklist, childhealthsite, animalresuce, techno, developers, section, developed, burrowing, arou nd, welcome, character, instead, kittenhood, directly, stopping, directions, people, exception, prob ably, appreciate, webring, childhealthsite2, sandboxes, altlist, animalresuce1, imglist, security, a pplets, children, titlelist, resource, developers, length, random, linknumber, thebreastcancersite, thechildhealthsite, browse, however, anonymous, member |
techno-kitten.com - rank der domain 956795 (421967 in US)
|
| Computers/Programming/Development_Tools/Development_Environments/PowerBuilder/3rd_Party_Products_and_Developer_Tools |
| zum Seitenanfang ↑ |
| Congress Plans DMCA Sequel: The SSSCA |
| Slashdot | Congress Plans DMCA Sequel: The SSSCA |
| http://slashdot.org/article.pl?sid=01/09/08/0238200 |
| "The sequel is called the 'Security Systems Standards and Certification Act,' and it requires PCs an d consumer electronic devices to support 'certified security technologies' to be approved by the Com merce Department." News and reader discussion. [Slashdot] |
| Congress Plans DMCA Sequel: The SSSCA -- article related to United States. |
| |
| writes, computer, september, filter, stories, viewname, saturday, government, people, pageload, disn ey, insightful, should, software, things, against, content, computers, security, rights, something, homepage, copyright, function, before, industry, interesting, technology, control, parent, equipment , hollings, digital, congress, another, because, hardware, certified, protect, create, window, prote ction, technologies, federal, slashdot, understand, system, anything, anyone, without, products |
slashdot.org - rank der domain 1773 (711 in US)
|
| Society/Issues/Intellectual_Property/Copyrights/Consumer_Broadband_and_Digital_Television_Promotion_Act/News_and_Media |
| zum Seitenanfang ↑ |
| Andrew Lloyd Webber Reveals Title of 'Phantom' Sequel |
| Andrew Lloyd Webber Reveals Title of 'Phantom' Sequel! 2008/05/30 |
| http://www.broadwayworld.com/viewcolumn.cfm?colid=28462 |
| In an interview with BBC online while talking about the talent search competition 'I'd Do Anything', Andrew Lloyd Webber revealed the title of the much talked about upcoming Phantom of the Opera seque l currently in the works. |
| In an interview with BBC online while talking about the talent search competition "I'd Do Anyth ing", Andrew Lloyd Webber revealed the title of the much talked about upcoming Phantom of the O pera sequel currently in the works. |
| Andrew Lloyd Webber Reveals Title of 'Phantom' Sequel!, Broadway |
| background, decoration, height, tickets, padding, tickets, position, border, jquery, phantom, family , margin, absolute, 5985687329815214, 999999, florida, california, fieldset, ffe92f, googleaddslot, document, function, ffffff, visited, cities, review, c5c5c5, normal, andrew, underline, yellow, webb er, decoration, helvetica, verdana, bottom, broadway, verdana, jersey, translator, newimages, google , newicons, sequel, broadwayworld, arizona, weight, family, wicked, location, weight |
broadwayworld.com - rank der domain 18205 (6872 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/L/Love_Never_Dies |
| zum Seitenanfang ↑ |
| A Sequel to The Philosophy of Railroads |
| A Sequel to the Philosophy of railroads - Google Books |
| http://books.google.com/books?id=2qoE_th8T5oC |
| Facsimile of Keefer's 1856 publication. |
| |
| |
| google, preview, window, u0026source, similarbooks, u0026printsec, frontcover, canada, function, aut hors, embeddable, viewability, u0026sig, u0026zoom, document, thumbnail, u0026img, subject, philosop hy, noview, thomas, railroads, keefer, registerhover, railroads, sequel, important, ijcaaaaaiaaj, le gislative, jdxcaaaaiaaj, getelementbyid, public, laokqqaacaaj, ockaqaaiaaj, assembly, parliament, ve rsions, height, wrbsraaacaaj, padding, appendchild, toronto, booklist, history, archives, margin, mi llion, autodir, u0026edge, border, google |
google.com - rank der domain 1 (1 in US)
|
| Science/Technology/Civil_Engineering/History/People/Keefer,_Thomas_Coltrin |
| zum Seitenanfang ↑ |
| Playbill News: Cat Destroys Lloyd Webber's Phantom Sequel Score |
| Cat Destroys Lloyd Webber's Phantom Sequel Score - Playbill.com |
| http://www.playbill.com/news/article/108816.html |
| After putting felines in the spotlight for nearly two decades, one would think the furry creatures w ould have more respect for Cats composer Andrew Lloyd Webber. By Andrew Gans. |
| After putting felines in the spotlight for nearly two decades, one would think the furry creatures w ould have more respect for Cats composer Andrew Lloyd Webber. |
| Cat Destroys Lloyd Webber's Phantom Sequel Score, Phantom in Manhattan, Andrew Gans |
| webber, playbill, phantom, andrew, broadway, thefield, addthis, prince, features, composer, london, musical, stilgoe, richard, castle, wainwright, campus, entries, writing, forsyth, shannon, manhattan , destroys, toppers, theatre, robert, computer, header, dynamic, 000000, sequel, folles, sequel, con tainer, mouseovertabsmenu, dynamicdrive, contact, advertise, merchandise, google, policy, stumbleupo n, privacy, article, options, playbill, ffea00, collector, facebook, friendly, background |
playbill.com - rank der domain 16531 (6130 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/P/Phantom_of_the_Opera/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| BroadwayWorld: Andrew Lloyd Webber Confirms 'Phantom' Sequel |
| Andrew Lloyd Webber Confirms 'Phantom' Sequel 2007/03/09 |
| http://www.broadwayworld.com/viewcolumn.cfm?colid=16517 |
| The Tony Award-winning composer and impresario, has confirmed that he will indeed be going ahead wit h a previously announced sequel to his blockbuster hit The Phantom of the Opera. |
| Andrew Lloyd Webber, the Tony Award-winning composer and impresario, has confirmed that he will inde ed be going ahead with a previously announced sequel to his blockbuster hit The Phantom of the Opera . |
| Andrew Lloyd Webber Confirms 'Phantom' Sequel, Broadway |
| background, decoration, height, padding, tickets, tickets, position, border, jquery, family, margin, 999999, 5985687329815214, california, florida, absolute, googleaddslot, fieldset, document, functio n, ffffff, ffe92f, visited, cities, newimages, newicons, broadwayworld, decoration, translator, revi ew, jersey, yellow, helvetica, bottom, underline, c5c5c5, normal, verdana, broadway, google, verdana , letter, spacing, weight, family, phantom, carolina, andrew, weight, webber, display |
broadwayworld.com - rank der domain 18205 (6872 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/P/Phantom_of_the_Opera |
| zum Seitenanfang ↑ |
| Joaqrophenia |
| Joaqrophenia2 : JOAQROPHENIA THE SEQUEL |
| http://groups.yahoo.com/group/Joaqrophenia2/ |
| Joaquin Phoenix Yahoo! Group. |
| Joaqrophenia2: JOAQROPHENIA THE SEQUEL |
| Joaqrophenia2, Phoenix, Joaquin |
| window, searches, document, ygmabt, ygmapromo, object, function, answers, questions, joaqrophenia2, getelementbyid, margin, groups, padding, thefield, yahoogroups, joaqrophenia, groups, script, return , popularsearches, weight, setattribute, ygmabtpromo, instructions, spanish, 12621715, 13811714, 170 5760967, answer, 8pgswkjinqms, 13105339, questions, teqyegazti4vwkxemnoac1z8, tn8wa0pdhem, sequel, s earch, undefined, typeof, member, 5857106, position, maxage, public, uhtrending, format, yahooapis, callback, watchung, diagnostics, exchange |
yahoo.com - rank der domain 4 (4 in US)
|
| Arts/People/P/Phoenix,_Joaquin |
| zum Seitenanfang ↑ |
| Universal Hint System Hints |
| Riven: The Sequel to Myst Hints from UHS - Not your ordinary walkthrough |
| http://www.uhs-hints.com/uhsweb/riven.php |
| Select specific questions and view hints in progressively detailed steps, from subtle nudges to full answers. |
| Universal Hint System hints for Riven: The Sequel to Myst. The UHS shows you just the hints you nee d, unlike a traditional walkthrough. |
| Riven: The Sequel to Myst, hints, walkthrough, Universal Hint System, UHS, Red Orb Software, help, g ames, computer games, tips, solutions, cheats |
| sequel, island, document, walkthrough, addblockingcategories, cheats, permission, system, universal, copyright, respective, version, access, unhelpful, somewhat, helpful, ordinary, readers, getelement sbytagname, margin, object, workshop, javascript, script, village, redistribution, moeity, endgame, prison, posted, copyrighted, protocol, location, author, related, average, permissions, ordinary, wa lkthrough, comments, property, setaccount, holders, companies, products, related, referenced, graphi cs, within, trademarks, authors |
uhs-hints.com - rank der domain 274937 (110241 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Myst_Series/Riven/Hints |
| zum Seitenanfang ↑ |
| City Limits: A Birthright Sequel RPG |
| City Limits: A Birthright Sequel |
| http://asylums.insanejournal.com/city_limits/ |
| Follow up to the original text-based role-playing game, Birthright, set within the Buffy the Vampire Slayer and Angel universe with limited canon character interaction. |
| |
| |
| comment, epilogue, limits, characters, scrollbar, birthright, background, insanejournal, margin, rhi annon, 2e1b1d, limits, epilogues, 2014notes, location, filter, community, rhiannon, c1aeb0, opacity, writers, calendar, decoration, family, different, 000000, border, alternate, disregards, november, entries, auwhere, universe, chicagowhen, living, epilogue, userinfo, arrangements, contain, retired, slightly, another, october, mention, chicagodate, joseph, former, setting, character, rpgbirthright , sequel |
insanejournal.com - rank der domain 5042 (648 in CN)
|
| Arts/Television/Programs/Horror/Buffy_the_Vampire_Slayer/Games |
| zum Seitenanfang ↑ |
| Carrie -- The Horror Phenomenon |
| Carrie: The Horror Phenomenon -- |
| http://www.freewebs.com/ilovecarriewhite/ |
| A fan site about the original 1976 classic, the 1999 sequel, and the 2002 remake with scripts of all three, along with information about the films including goofs and bloopers. |
| |
| Carrie, Rage, Carrie 2, movie, sequel, remake, Sissy Spacek, Piper Laurie, Emily Bergl, Angela Betti s |
| phenomenon, horror, carrie |
freewebs.com - rank der domain 3735 (1422 in US)
|
| Arts/Movies/Titles/C/Carrie_Series |
| zum Seitenanfang ↑ |
| Amazing Comics: X-Men 2 |
| Amazing Comics - Dossier - X-Men II |
| http://www.amazingcomics.it/dossier23.htm |
| Recensione del sequel diretto da Bryan Singer, ispirato ai personaggi del fumetto Marvel. |
| X-Men II: il film sequel diretto da Bryan Singer |
| |
| quello, misere, finanze, animazione, purtroppo, supporta, questo, dossier, amazing, comics, iframe, appassionato, fumetti, sempre, presicce |
amazingcomics.it - rank der domain 962272 (17654 in IT)
|
| World/Italiano/Arte/Cinema/Titoli/X/X-Men |
| zum Seitenanfang ↑ |
| GameFAQs: Spellcasting 201: The Sorcerer's Appliance |
| Spellcasting 201: The Sorcerer's Appliance Review for PC: A Gratuitous But Great Sequel - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/review/R5624.html |
| Review of the game. |
| For Spellcasting 201: The Sorcerer's Appliance on the PC, a reader review titled "A Gratui tous But Great Sequel". |
| |
| spellcasting, imgelem, document, classname, playstation, return, meretzky, getelementbyid, sorcerer, adventure, container, slightly, puzzles, review, appliance, itrkid, iphone, location, series, inter active, gamers, recommend, platforms, design, nintendo, anyone, campus, writing, gamefaqs, parentele m, college, complete, arcade, advertise, pledges, gamespot, things, course, genesis, dreamcast, meta critic, comedic, puzzle, occasional, parentid, search, university, player, password, something, sequ el |
gamefaqs.com - rank der domain 941 (399 in US)
|
|
| zum Seitenanfang ↑ |
| GameSpot |
| Dungeon Siege II Hands-On Impressions - E3 2004 - PC Previews at GameSpot |
| http://www.gamespot.com/pc/rpg/dungeonsiege2/preview_6098356.html |
| E3 impression by Andrew Park, "Dungeon Siege II seems like a promising sequel indeed." |
| We spend some time with the upcoming sequel to Gas Powered Games' hack-and-slash role-playing game. |
| |
| dungeon, imgelem, document, return, original, sequel, getelementbyid, character, itrkid, feature, ch aracters, system, gamespot, powered, control, vessel, combat, seemed, sequence, images, gameplay, pa rentelem, player, engine, reviews, community, optional, playing, ground, microsoft, previews, attack , studios, ctrkprefix, parentid, itrkuri, motivations, comment, simply, scheme, newuri, individual, desturi, online, adventures, lambert, upcoming, rbxcprefixed, netxp1, review, function |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Roleplaying/D/Dungeon_Siege_Games/Dungeon_Siege_II |
| zum Seitenanfang ↑ |
| Prison Break's Fichtner Joins Cast of Batman Begins Sequel |
| Prison Break's Fichtner joins cast of Batman Begins sequel |
| http://www.buddytv.com/articles/prison-break/prison-breaks-fichtner-joins-c-5972.aspx |
| William Fichtner, who plays Detective Mahone on Prison Break, has become the latest addition to the all-star cast of The Dark Knght. |
| Prison Break's Fichtner joins cast of Batman Begins sequel |
| Prison Break - News, Photos, TV Shows, Actors, Videos, Games, Trivia, Personality Quiz, Episodes |
| controls, templates, batman, contextmenuitem, function, begins, fichtner, buddytv, buddytv, prison, prison, document, sequel, articles, ocurrentflyout, fichtner, hascontent, become, season, flyoutid, 8927547412499869, images, contextmenu, listitemid, william, actors, photos, elcontainer, googleaddsl ot, personality, photos, franchise, google, casting, height, thumbnail, imageviews, william, analyti cs, quantcast, teller, knight, templating, 728x90, michael, article, miller, wentworth, global, omou seregionmgr, project |
buddytv.com - rank der domain 11797 (4375 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| Porridge and Going Straight |
| Porridge - The unofficial homepage of the BBC TV comedy Porridge and its sequel, Going Straight |
| http://www.porridge.org.uk/ |
| Fan site featuring cast information, an episode guide, multimedia files, pictures and icons. |
| Porridge - The unofficial homepage of the BBC TV comedy Porridge and its sequel, Going Straight |
| porridge, ronnie barker, seven of one, cumbria, cumberland, norman stanley fletcher, going straight |
| porridge, series, copyright, criminal, episode, straight, design, nottingham, created, updated, unfo rtunately, history, homeaboutepisodesinmatestellypicsclipslinksnewsguest, worked, quality, problems, product, please, porridge, promoting, infringement, intended, others, belongs, besides, interesting ly, called, prisoner, escort, entailed, prison, remote, convicted, journey, entitled, sequel, comedy , unofficial, homepage, ronnie, barker, sunday, cumbria, during, feature, length, concerning, arkwri ght, northern, shopkeeper, specials |
| (SLD : porridge.org.uk) |
| Regional/Europe/United_Kingdom/Arts_and_Entertainment/Television/Programmes/Comedy/Porridge |
| zum Seitenanfang ↑ |
| RPG Vault |
| RPG Vault: Deus Ex: Invisible War Review |
| http://rpgvault.ign.com/articles/448/448693p1.html |
| Review of Windows version by Jonathan Bega, with screen shots. |
| Deus Ex: Invisible War Review
ION Storm's genre-defying sequel in a stylish, shadowy environmen t of competing factions and shifting allegiances
ION Storm's genre-defying sequel in a stylish , shadowy world |
| Deus Ex: Invisible War, Deus Ex: Invisible War Review ,review |
| invisible, document, networklinks, interview, background, repeat, experience, character, faction, im ages, margin, padding, related, before, second, cyborg, future, shooter, advance, person, greater, d ecide, course, previous, various, storyline, different, between, factions, compelling, example, mome nt, endings, impact, articles, december, having, tomatoes, direct2drive, teamxbox, fileplanet, games py, cheatscodesguides, gamestats, askmen, rotten, netimp, members, called, sequel, natural |
ign.com - rank der domain 361 (169 in US)
|
| Games/Video_Games/Shooter/D/Deus_Ex_Series/Deus_Ex_-_Invisible_War/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Dragonball Legends |
| Dragonball Legends - Live Action Dragon Ball Reborn Evolution Movie Z GT Kai |
| http://dragonball.zeldac.com |
| Features Dragonball movie news, character information, and multimedia. |
| Dragonball Reborn and Evolution movie sequel news updates and Dragon Ball Z GT Kai anime news and up dates. The source for live action Dragon Ball. Trailers, pictures, images, screenshots, videos. |
| dragon, ball, dragonball, z, gt, kai, reborn, evolution, live action, movie, trailer, sequel, news, dragonball evolution, goku, piccolo, son, justin, chatwin, james, marsters, bulma, emmy, rossum, db, dbz, dbgt, legends, vegeta, saiyan |
| dragon, config, avenged, dragonball, dblegends, evolution, reborn, linkname, linkurl, comments, rele ase, dragon, smooth, raging, funimation, releases, sequel, sequel, version, rumors, series, 000000, filming, released, 333333, helvetica, family, release, height, border, official, english, opening, b ackground, evolution, online, dragon, season, happen, normal, function, jquery, mexico, officially, comments, releases, currently, filming, dragonball, september, daizex |
zeldac.com - rank der domain 834363 (344829 in US)
|
| Arts/Animation/Anime/Titles/D/Dragon_Ball_Series/Information |
| zum Seitenanfang ↑ |
| Cinema Zone: Saw 2 - Il Sequel che non ti aspetti |
| Recensione Saw 2 - La soluzione dell'enigma (2005) - Saw 2: il sequel | Movieplayer.it |
| http://cinema.castlerock.it/recensioni.php/id=1675 |
| La recensione del film, a cura di Adriano Aiello. |
| Leggi la recensione del film Saw 2 - La soluzione dell'enigma (Saw II, 2005) su Movieplayer.it. Le o pinioni e i commenti della redazione e dei lettori. |
| |
| slider, sequel, articoli, recensioni, enigma, soluzione, height, horizontal, archivio, precedente, s uccesso, giochino, position, background, articoli, movieplayer, margin, aspetti, prossimamente, docu ment, predators, uscite, horror, enigmista, cinema, thriller, rimane, diventare, niente, funzionale, segreti, presenta, ultime, truculento, eccessivamente, enigmista, script, produzione, bousman, pecc he, recitazione, scrittura, dialoghi, numerose, intelligenza, pretestuosit, previsto, migliorando, p articolare, tweetmeme, luglio |
| (SLD : castlerock.it) |
|
| zum Seitenanfang ↑ |
| Funcom Announces The Longest Journey: Static |
| The Longest Journey: Static First Look - PC Previews at GameSpot |
| http://www.gamespot.com/pc/adventure/longestjourney2wt/preview_6028573.html |
| "The Norwegian developer unveiled its upcoming adventure sequel in a brief trailer at E3 2003." [Gam eSpot] |
| The Norwegian developer unveiled its upcoming adventure sequel in a brief trailer at E3 2003. |
| |
| imgelem, journey, document, longest, gamespot, function, trailer, return, static, getelementbyid, sc ript, previews, cheats, images, sequel, dreamfall, reviews, itrkid, content, interactive, player, co mment, andreas, location, facebook, adventure, connect, mature, features, parentelem, techrepublic, articles, universe, dreamfall, cbsnews, cbssports, titles, mysimon, looked, search, original, metacr itic, maxpreps, movietome, moneywatch, summary, videos, posted, downloads, answers, longest |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Longest_Journey_Series,_The/Dreamfall |
| zum Seitenanfang ↑ |
| UnderGround Online |
| UGO.com Games - Master of Orion 3 review of the PC space strategy game sequel from Quicksilver and Infogrames |
| http://www.ugo.com/channels/games/features/moo3/review.asp |
| Review by Jonah Falcon, A-. "There are some conceptual kinks in the armor, but nothing that a good p atch and future expansion couldn't fix." |
| Master of Orion 3 review of the PC space strategy game sequel from Quicksilver and Infogrames |
| Master of Orion 3 review of the PC space strategy game sequel from Quicksilver and Infogrames |
| master, hellip, planet, planets, example, document, though, empire, technology, series, system, mili tary, entertainment, develop, however, research, movies, typeof, undefined, region, unrest, number, buildings, technologies, design, cachebuster, galaxy, become, walkthrough, quicksilver, funding, pla netary, strange, influence, telefile, enough, without, feature, strategy, gamespy, should, ability, bioharvest, wrestling, players, course, production, advance, another, future, addition |
ugo.com - rank der domain 11653 (4382 in US)
|
| Games/Video_Games/Strategy/Turn-Based/Master_of_Orion_Series/Master_of_Orion_III/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| The Utnapishtim Sequel |
| The Utnapishtim Sequel |
| http://utnapishtim.net/ |
| An autobiographical novel and dissertation covering India-West affairs and a variety of topics. |
| Story/dissertation: India-West affairs; Meditation/paranormal: religion, psychology, law, politics; Crimes by gurus. |
| yogi, Matthew, swami shyam, buddha, abraham maslow, gospels, india, krishna, revolution, paranormal , terrorism, utnapishtim, dennis lloyd, asura, dravidian |
| utnapishtim, culture, krishna, healthy, divine, thousand, darkness, sequel, matthew, another, essenc e, history, without, devotee, gilgamesh, ancient, teacher, website, diatessaron, preview, people, in dividuals, possible, gospels, divide, should, polytheism, teaching, anyone, elimination, harshly, ju dged, continued, polytheistic, religion, tenets, taught, monotheist, tradition, civilization, friend , between, middle, govern, affairs, provided, universe, lawgiver, physical, conceived, dennis |
| (SLD : utnapishtim.net) |
| Society/Religion_and_Spirituality/Religious_Studies/Eastern_Religions |
| zum Seitenanfang ↑ |
| Janet's Titanic Fan Fiction |
| MY FAN FICTION SEQUEL TO JAMES CAMERON'S Titanic: Rose Dawson |
| http://www.angelfire.com/movies/TitanicFanFiction/JanetsFanFiction.htm |
| A story about Rose after Titanic. |
| |
| Titanic, Rose, Dawson, Fan Fiction, Stories |
| dawson, fiction, please, cameron, sequel, smekar, titanic, titanic |
angelfire.com - rank der domain 1912 (770 in US)
|
| Arts/Movies/Titles/T/Titanic/Fan_Fiction |
| zum Seitenanfang ↑ |
| GameSpot |
| RollerCoaster Tycoon 2 Review for PC - GameSpot |
| http://www.gamespot.com/pc/strategy/rollercoastertycoon2/review.html |
| [7/10] By Brett Todd. "... successful in some aspects, but ultimately isn't a fulfilling sequel to o ne of the best computer games of the past decade." |
| Newcomers will likely find RollerCoaster Tycoon 2 enjoyable, but if you were a fan of the original, you'll probably have a hard time believing that you waited so long for what the sequel has to offer. |
| RollerCoaster Tycoon 2 Review for PC, PC RollerCoaster Tycoon 2 Review, RollerCoaster Tycoon 2 Revie w, PC RollerCoaster Tycoon 2, RollerCoaster Tycoon 2 for PC, RollerCoaster Tycoon 2 Article, RollerC oaster Tycoon 2 Hands On |
| tycoon, rollercoaster, imgelem, document, gamespot, function, sequel, reviews, review, original, ret urn, scenarios, script, getelementbyid, player, itrkid, objectives, cheats, connect, scenario, faceb ook, expansion, roller, enjoyable, prices, parentelem, content, everyone, location, interactive, and reas, tycoon, beginner, feature, articles, maxpreps, cbssports, sports, college, cbsnews, cbsinterac tive, summary, previews, features, rollercoaster, amenities, universe, images, videos, rsaquo, score s |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Simulation/God_Games/Tycoon_Games/RollerCoaster_Tycoon_Series/RollerCoaster_Tycoon_2/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Doom II for PC at GameSpot |
| Doom II Review for PC - GameSpot |
| http://www.gamespot.com/pc/action/doom2/review.html |
| Reviewed by Peter Scisco, [8.5/10]. "Bigger, badder, and bloodier than the original, this sequel ext ends the carnage started in Doom." |
| Bigger, badder, and bloodier than the original, this sequel extends the carnage started in Doom. |
| Doom II Review for PC, PC Doom II Review, Doom II Review, PC Doom II, Doom II for PC, Doom II Articl e, Doom II Hands On |
| imgelem, document, gamespot, function, return, review, reviews, original, script, getelementbyid, it rkid, player, interactive, cheats, content, cbsiadglobal, connect, facebook, mature, location, seque l, monsters, metacritic, andreas, parentelem, articles, insider, mancubus, techrepublic, shopper, sh owtime, mysimon, search, smartplanet, maxpreps, moneywatch, action, movietome, images, features, pre views, videos, downloads, studio, answers, titles, looked, summary, score8, college, faction |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Shooter/D/Doom_Series/Doom_II_-_Hell_on_Earth/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Trilogy of Terror II Review |
| Trilogy of Terror II |
| http://www.xmission.com/~tyranist/horror/reviews/t/TrilogyofTerror2.html |
| A review of the movie. |
| |
| |
| trilogy, killer, survives, though, terror, sequel, either, stories, killer, ending, anthony, curtis, second, unbelievably, better, honest, celebrity, appears, hurray, tyranist, someone, richard, mathe son, segment, remake, victim, movies, decided, twenty, another, someone, nudity, sequel, location, w anton, insist, ignored, unresolved, secluded, threat, forget, characters, associated, unfulfilled, p romise, invite, skulls, former, anything, crappy, future |
xmission.com - rank der domain 27178 (10099 in US)
|
| Arts/Movies/Titles/T/Trilogy_of_Terror_Series/Trilogy_of_Terror_2 |
| zum Seitenanfang ↑ |
| Aliens: The Sequel |
| Aliens: The sequel - Physics - Salon.com |
| http://archive.salon.com/tech/view/2000/07/05/firmage/ |
| Salon.com interview of Firmage by Janelle Brown |
| A tale of off-world visitation gave USWeb founder Joe Firmage no end of trouble -- but he's stil l alive, kicking and raising gobs of venture capital for his latest crusade. |
| carl sagan productions,executives,us web,astronomy,firmage,extraterrestrials,view from the top,physi cs,aliens,joe firmage,interviews,the truth,carl sagan |
| science, people, widget, valley, physics, scientific, extraterrestrial, stories, voyager, aliens, se quel, project, shared, believe, firmage, object, whether, things, silicon, 875233, talking, janelle, firmage, function, manager, questions, attachchicklet, called, issues, certainly, venture, universe , really, cosmos, revolution, return, future, simple, cosmos, interesting, company, particular, omni ture, visited, public, talked, opportunity, breitbart, others, travel, pursuing |
salon.com - rank der domain 1986 (801 in US)
|
| Society/Paranormal/UFOs/People/Firmage,_Joe |
| zum Seitenanfang ↑ |
| Hackers vs. Hollywood, the Sequel |
| Hackers vs. Hollywood, the Sequel |
| http://www.wired.com/entertainment/music/news/2001/05/43450 |
| "Music industry lawyers plan to tell a federal appeals court that a DVD-descrambling program is prim arily useful to hackers and should be outlawed." By Declan McCullagh. [Wired] |
| The hacker magazine that posted the code that can descramble DVDs goes back to court Tuesday, appeal ing its highly publicized loss. Declan McCullagh reports from Washington. |
| |
| getelementbyid, document, hollywood, program, global, eacute, request, params, repositorytargeters, registry, function, digital, digest, magazine, rightrail, entertainment, contentpage, subscribe, nav bar, hackers, sequel, article, entertainment, appeals, before, details, listelement, behalf, kaplan, yorker, felten, arguments, reddit, import, reviews, textpref, hackers, webmonkey, hacker, subservic es, copyright, attorney, services, subscription, sections, utility, display, visibility, popular, ta lking, commented |
wired.com - rank der domain 799 (349 in US)
|
| Society/Issues/Intellectual_Property/Digital_Rights_Management/DVD_Encryption/Articles |
| zum Seitenanfang ↑ |
| BBC Films: American Pie - The Wedding |
| BBC - Films - review - American Pie: The Wedding |
| http://www.bbc.co.uk/films/2003/08/08/american_pie_the_wedding_2003_review.shtml |
| Critic Nev Pierce says "Jim and the boys are back in a sequel which is as warm as the original, if s ometimes yucky tasting." |
| Jim and the boys are back in a sequel which is as warm as the original, if sometimes yucky tasting. |
| review, bbc, film, movie, Jason Biggs,Seann William Scott,Eddie Kaye Thomas,Alyson Hannigan,January Jones |
| archive, london, american, wedding, yorkshire, reviews, alyson, hannigan, interview, william, thomas , sussex, manchester, trailer, islands, cinema, central, minutes, sequel, includes, rating, things, hereford, hampshire, greater, pageaccess, worcester, hertfordshire, version, gloucestershire, dorset , derbyshire, cumbria, bbcthis, riding, homeexplore, lancashire, leicestershire, somerset, staffords hire, shropshire, oxfordshire, nottinghamshire, suffolk, surrey, warwickshire, teesside, northumberl and, northamptonshire, contenttext, lincolnshire |
bbc.co.uk - rank der domain 49 (1 in GB)
|
| Arts/Movies/Titles/A/American_Pie_Series/American_Wedding |
| zum Seitenanfang ↑ |
| Deuteros - The Next Millennium |
| Deuteros - The Next Millennium |
| http://www.dixiak.com/deuteros/ |
| A short writing dedicated to the Millennium 2.2 sequel which was released on the Atari ST. |
| |
| classic, gaming, atari, deuteros, fomm, millennium, the next millennium, atari, ian bird, ian, bird, jai redman, jai, redman, methanoids, earth city, sol, millennium 2.2, deteros, duteros, deuter, deu tero, devteros, atari st, atari ste, activision, galaxians, dixiak, narco, novacom, novagen |
| millennium, deuteros, testing, walker, cummins, gallagher, richard, martin, designed, sequel, progra mmed, graphics, redman |
| (SLD : dixiak.com) |
| Games/Video_Games/Console_Platforms/Atari |
| zum Seitenanfang ↑ |
| Mega-sequel, mega-troubles |
| Mega-sequel, mega-troubles / 'Reloaded,' shot partly in the Bay Area, faced tragedies |
| http://www.sfgate.com/cgi-bin/article.cgi?file=/chronicle/archive/2003/05/11/MO83004.DTL |
| Hugh Hart's article on the difficulties faced by the filmmakers during the production. |
| "It was like going on the Crusades," says producer Joel Silver. He's the man behind action franchises such as the "Lethal Weapon" and "Die Hard" series, so Silver is accu stomed to big budgets, big stars and big... |
| |
| plconfig, matrix, reloaded, sequel, francisco, chronicle, document, sfgate, troubles, silver, effect s, partly, article, tragedies, location, digital, mo83004, million, action, freeway, alameda, weavin g, really, bigger, little, computer, formsubmit, entertainment, business, oakland, sfgate, sequence, search, giants, comments, soccer, reeves, months, fishburne, education, laurence, during, generated , partner, toyota, started, australia, subscribe, suspect, shootout, article |
sfgate.com - rank der domain 808 (353 in US)
|
| Arts/Movies/Titles/M/Matrix_Series/Matrix_Reloaded,_The/Articles_and_Interviews |
| zum Seitenanfang ↑ |
| Haro Online: Dr Dolittle |
| Dr. Dolittle 2 |
| http://www.haro-online.com/movies/dr_dolittle_2.html |
| Negative review which looks at plot, believablity and comments on why the reviewer would say making the sequel was not a good thing. |
| |
| |
| dolittle, murphy, forest, family, archie, enough, sequel, quickly, children, minutes, company, docto r, animals, charisse, convincing, nothing, become, kudrow, western, pacific, remake, change, cannot, colors, amount, retain, chameleon, drunenk, monkeys, milked, beaver, situations, longer, prolongs, pollack, contact, needlessly, logging, entire, around, revolving, animal, voices, classic, frankie, including, nobody, parades, although, antics, tiring |
haro-online.com - rank der domain 929993 (380490 in US)
|
| Arts/Movies/Titles/D/Dr._Dolittle_Series/Dr._Dolittle_2 |
| zum Seitenanfang ↑ |
| 1UP |
| Far Cry 2 Preview from 1UP.com |
| http://www.1up.com/do/previewPage?cId=3168000&p=4 |
| Preview, by Sam Kennedy: "It's great to see Ubisoft expanding on the original's open world approach with Africa, and given what we've seen so far, we have pretty high hopes for this sequel." |
| |
| |
| ubisoft, margin, sequel, really, twitter, posted, setting, featuredblogs, bottom, africa, invite, im pressive, padding, friend, enemies, previews, previews, mercenary, though, through, objectives, enti re, landscape, factions, overall, example, border, original, previews, interaction, starcraft, revea ls, excited, assassin, because, miscellaneous, person, dragon, developers, pretty, causing, african, rendered, members, damage, height, likely, recent, montreal, jungles, reviews |
1up.com - rank der domain 8552 (3245 in US)
|
| Games/Video_Games/Shooter/F/Far_Cry_Series/Far_Cry_2 |
| zum Seitenanfang ↑ |
| HARO Online: Jeepers Creepers 2 |
| Jeepers Creepers 2 |
| http://www.haro-online.com/movies/jeepers_creepers2.html |
| Haro reviews the film: "...doesn't even do a good job of setting up another sequel, which, unfortuna tely, will probably happen. " |
| |
| |
| creepers, jeepers, creeper, horror, particularly, sequels, twenty, person, really, scream, before, s woops, effects, attacks, sequel, stupid, coming, because, people, outside, manager, movies, girlfrie nd, movies, eventually, minutes, violence, language, expendable, otherwise, french, history, macbeth , minxie, contact, careers, wanted, advice, habits, somehow, discerns, decent, another, sticks, audi ence, unfortunately, moments, probably, setting, running, memorable |
haro-online.com - rank der domain 929993 (380490 in US)
|
| Arts/Movies/Titles/J/Jeepers_Creepers_Series/Jeepers_Creepers_2/Reviews |
| zum Seitenanfang ↑ |
| TW-Light |
| TW-Light |
| http://tw-light.berlios.de/ |
| An open source clone/sequel to the Star Control II. General information, development team, downloads , wiki, and discussion forum. |
| Homepage of TW-Light. |
| TW-Light timewarp SC sc1 sc2 star control uqm the ur-quan masters ur-quan orz spathi adventure opens ource game zip yurand fork TW |
| control, nobody, exception, compile, windows, hosted, latest, mailing, subscribe, access, hardware, always, source, sequel, downloads, database, currently, includes, developed, actively, derivative, w ritten, timewarp, legacies, called, combat, portion, although, adventure, portable |
berlios.de - rank der domain 25957 (2984 in CN)
|
| Games/Video_Games/Action/Space_Combat/Star_Control_Series |
| zum Seitenanfang ↑ |
| 1Up: Interview with Developer Keita Takahashi |
| Katamari Love from 1UP.com |
| http://www.1up.com/do/feature?cId=3142234&did=1 |
| The developer talks about fan support convincing him to make a sequel and new features in We Love Ka tamari. |
| |
| |
| footer, walkthrough, katamari, sequel, networklinks, takahashi, padding, background, damacy, margin, screens, images, document, topgames, networkfooter, pagetracker, people, center, really, cheats, or iginal, characters, topdownloads, topcheats, comment, wonder, something, society, innovative, receiv ed, reality, bottom, fantasy, decoration, japanese, galaxy, crackdown, copyright, repeat, together, exciting, strategy, script, innovation, stories, contests, industry, reviews, previews, podcasts, br owse |
1up.com - rank der domain 8552 (3245 in US)
|
| Games/Video_Games/Platform/Katamari_Series |
| zum Seitenanfang ↑ |
| RPGFan |
| RPGFan Reviews - Phantasy Star III |
| http://www.rpgfan.com/reviews/phantasystar3/Phantasy_Star_3.html |
| Review by Jeremy Moore. [86%] "The ending of PS3 was intriguing and left a huge "What if" for a sequ el." |
| |
| |
| characters, phantasy, character, graphics, journey, people, gameplay, rpgfan, gajshost, graphics, ba ttle, effects, document, quickly, however, either, overall, pagetracker, rescue, system, sequel, her oes, things, intriguing, discover, facing, covered, problems, personality, worthy, doable, nothing, outstanding, ensure, safety, combat, reasonably, anyway, complete, ending, homeworld, glaring, adequ ate, kicked, 3cscript, unescape, google, analytics, advertising, policy, location |
rpgfan.com - rank der domain 100774 (38697 in US)
|
| Games/Video_Games/Roleplaying/P/Phantasy_Star_Series/Phantasy_Star_III/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Avid |
| avid hifi ltd :: index |
| http://www.avidhifi.co.uk |
| Equipment support, cables and turntables manufacturer such as Acutus, Volvere and Sequel. |
| |
| |
| reference, acutus, sequel, volvere, pulsare, cables, naimslide, platform, isorak, pulsus, london, ca mbridgeshire, arriving, norfolk, international, latest, denmark, canada, brazil, register, contact, technical, manuals, images, warranty, finland, norway, sweden, switzerland, zealand, philippines, po land, africa, singapore, russia, portugal, thailand, greece, france, opportunities, support, netherl ands, lithuania, products, turntables, anniversary, interconnect, overview, electronics, profiles, c ompany |
| (SLD : avidhifi.co.uk) |
| Business/Consumer_Goods_and_Services/Electronics/Audio/Analog |
| zum Seitenanfang ↑ |
| 1Up Review: Shadow Hearts: Covenant (PS2 ) |
| Shadow Hearts: Covenant Review from 1UP.com |
| http://www.1up.com/do/reviewPage?cId=3134959&did=1 |
| "In putting together the sequel to 2002's RPG sleeper Shadow Hearts, the artists formerly known as S acnoth appear to have obeyed a single guiding principle above all others: if it's ever been in an RP G before, make sure it's in Covenant, too." By Jeremy Parish. |
| |
| |
| covenant, character, hearts, shadow, through, characters, action, something, different, judgment, sy stem, unique, various, better, pretty, combat, fantasy, random, japanese, battle, requires, reviews, little, across, chrono, people, points, original, experience, nothing, attack, sanity, quality, act ual, skills, looking, things, success, battles, situations, played, sequel, graphics, everything, vi deos, together, acting, assorted, joachim, blanca, specific |
1up.com - rank der domain 8552 (3245 in US)
|
| Games/Video_Games/Roleplaying/S/Shadow_Hearts_Series/Shadow_Hearts_-_Covenant |
| zum Seitenanfang ↑ |
| Wikipedia |
| Cooking Mama - Wikipedia, the free encyclopedia |
| http://en.wikipedia.org/wiki/Cooking_Mama |
| Article describing gameplay, game modes, and the sequel. |
| |
| |
| cooking, player, wikipedia, majesco, minigame, recipes, nintendo, retrieved, review, recipe, review, wikipedia, cooking, screen, released, gamespot, vector, series, players, copies, million, kitchen, simplesearch, america, ingredients, gameplay, cookingmama, articles, animals, gamespot, puzzle, chan ges, article, collapsiblenav, enable, editwarning, wgnotice, september, unlocked, sequel, reception, gameplay, dinner, friends, eurogamer, portal, developed, different, minigames, additional, mastered |
wikipedia.org - rank der domain 6 (5 in US)
|
| Games/Video_Games/Simulation/Cooking_Mama_Series/Cooking_Mama |
| zum Seitenanfang ↑ |
| Killer Movies - Ocean's Twelve |
| Ocean's Twelve |
| http://www.killermovies.com/o/oceanstwelve/ |
| Sequel to the 2001 remake of Ocean's Eleven. News on the film's production. |
| |
| |
| twelve, trailer, clooney, oceans, quicktime, february, roberts, movies, soderbergh, january, starrin g, monday, wednesday, returning, thieves, george, office, reviews, thursday, medium, garcia, trailer quicktime, catherine, 2004not, original, 2003they, without, sequel, review, eleven, 2004with, 2004jo ining, pictures, revealed, casting, 2004basic, script, online, tuesday, member, releasesmessage, cha rtdvd, boardssearch, captain, americagreen, trailersbox, reviewsmovie, policy, archive, headlineslat est, updatesmovie |
killermovies.com - rank der domain 61331 (23010 in US)
|
|
| zum Seitenanfang ↑ |
| Playbill News: O'Brien to Direct and Crowley to Design Lloyd Webber's Phantom Sequel |
| |
| http://www.playbill.com/news/article/113725.html |
| Tony Award-winning director Jack O'Brien whose most recent Tony was for his direction of the Tom Sto ppard trilogy, The Coast of Utopia has found his latest stage project. By Andrew Gans. |
| |
| O'Brien to Direct and Crowley to Design Lloyd Webber's Phantom Sequel, Phantom in Manhattan, Andrew Gans, Phantom of the Opera, The, Majestic Theatre, Broadway |
| |
playbill.com - rank der domain 16531 (6130 in US)
|
| Arts/Performing_Arts/Theatre/Musicals/P/Phantom_of_the_Opera |
| zum Seitenanfang ↑ |
| RPGFan |
| RPGFan Previews - Final Fantasy X-2 |
| http://www.rpgfan.com/previews/ffx-2/ffx-2.html |
| "Final Fantasy X-2 represents many new paradigms for Square. Not only is it the first direct sequel to a Final Fantasy game, it is also the first in the series to feature action elements as well as th e first to have changing environments." Preview by Chris Winkler with screen shots. |
| |
| |
| fantasy, square, become, fiscal, release, current, selling, announcement, surfaced, firstly, feature , sequel, original, steady, stream, information, winkler, developer, publisher, previews, rpgfan, ne wsreviewspreviewspicturesrelease, datessoundtrackseditorialsforumsfeaturesstaff, playstation, platfo rm, format, update, preview, expected, release, before |
rpgfan.com - rank der domain 100774 (38697 in US)
|
| Games/Video_Games/Roleplaying/F/Final_Fantasy_Games/Final_Fantasy_X_Series/Final_Fantasy_X-2/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Cinema Confidential: The Matrix Reloaded |
| Cinema Confidential: The Matrix Reloaded |
| http://www.cinecon.com/movies.php3?m=matrix2 |
| Features news and information about the sequel. |
| |
| |
| matrix, interview, action, reloaded, weaving, monica, belluci, fishburne, pinkett, producer, silver, wachowski, directors, screenwriters, laurence, release, larger, version, warner, reeves, carrie, st arring, confidential, sequel, composer, enclave, separates, matter, sentinels, emboldened, morpheus, citizens, programmed, destroy, mankind, machine, chapter, trilogy, assumes, second, choreographer, summary, greater, command, cinema, extraordinary, powers, vincent, things, lohman, alison |
cinecon.com - rank der domain 957376 (403195 in US)
|
| Arts/Movies/Titles/M/Matrix_Series/Matrix_Reloaded,_The |
| zum Seitenanfang ↑ |
| Babylon 5 UK Web Site |
| Babylon 5 UK Web Site |
| http://www.brainsurgery.co.uk/b5.htm |
| Links, news and resources for fans of the show and its sequel, Crusade. |
| Babylon 5 UK Web Site. Links, news and resources for fans of this TV science fiction programme and i ts sequel, Crusade. |
| Babylon 5,B5,UK,U.K.,Crusade,fan,TV,lurker,Sigma957,Sigma 957,Wolf 359,SF,Sci-Fi,science fiction,tre k,culture,community,homepage,home page,index |
| babylon, rumours, information, events, bookmarks, rather, contents, further, worldwide, copyright, m erchandise, meanwhile, upcoming, favourite, obligatory, information, future, assembly, required, not ices, feedback, please, hunter, problems |
| (SLD : brainsurgery.co.uk) |
| Arts/Television/Programs/Science_Fiction_and_Fantasy/B/Babylon_5 |
| zum Seitenanfang ↑ |
| 1UP |
| Wario Land: Shake It! Hands-On Preview |
| http://www.1up.com/do/previewPage?cId=3168760 |
| Preview, by Jeremy Parish: "But does anyone really want to play a sequel to a portable title on a co nsole? In this case, they should -- Wario Land: Shake It! is quality stuff." |
| |
| |
| nintendo, enemies, previews, remote, previews, though, really, before, levels, through, shaking, pos ted, specific, sequel, console, things, elements, rather, resolution, screens, having, difficult, pl ayed, hidden, secrets, controlled, ground, honest, boards, cheats, firing, features, videos, reviews , excited, cannons, greater, apiece, slower, action, emphasis, moving, element, number, aspects, aim ing, direction, divided, exploiting, exploring, finally |
1up.com - rank der domain 8552 (3245 in US)
|
| Games/Video_Games/Platform/Mario_Games/Wario_Series/Wario_Land_-_Shake_It |
| zum Seitenanfang ↑ |
| An Improbable Sequel: Harry Potter and the Ivory Tower |
| An Improbable Sequel - Harry Potter and the Ivory Tower - NYTimes.com |
| http://www.nytimes.com/2001/05/12/arts/12MIDD.html |
| NY Times article (requires registration) on International Congress on Medieval Studies, where "the p ersistence of medieval archetypes in popular culture" was discussed - in works by J.K. Rowling and J .R.R. Tolkien |
| |
| Books and Literature, Colleges and Universities, Conventions and Conferences,University of Cincinnat i, Congress, Western Michigan University, Rice University,Kalamazoo, Bingen, Europe, Jonathan, Ithac a, Hannibal, Oxford |
| function, return, articletoolssharedata, document, medieval, encodeuricomponent, potter, section, ty peof, tolkien, undefined, description, university, opinion, shakespeare, window, parent, arthurian, indapif, prhost, isajax, kalamazoo, nytimes, plugins, swfver, scholars, navigator, indapmgrif, domai n, display, modern, shockwaveflash, conference, financial, exceptional, between, michigan, improbabl e, fantasy, harris, nytimes, hannibal, complete, considered, arthur, middle, sequel, travel, sports, health, popularity |
nytimes.com - rank der domain 109 (52 in US)
|
|
| zum Seitenanfang ↑ |
| Skyview Farm |
| Sequel Farm Horse Training Stable |
| http://www.skyview-farm.com/ |
| Specializes in Hunter/Jumper and Equitation training and instruction for all ages and levels. Includ es details of the facilities, trainer profiles, and showing schedule. Located in Sebastopol, Califor nia. |
| Sequel Farm hunter jumper horse barn specializes in Hunters, Jumpers, and Equitation training and in struction for all ages, levels. Located in Sisters, Oregon |
| horse training stables, sequel farm, hunter jumper horse barn, horse boarding stables, show horse tr aining, equitation training, show jumper training, hunter jumper training stables, english riding le ssons, horse riding lessons, green horse training, lesson horses, show barn experience, outdoor aren a with all weather footing, fcp barn with ventilated stalls, covered riding arena, turn-out paddocks , horse wash rack, english riding, flat work horse training, schooling horses, horse training, hunt seat equitation, diana field, audrey goldsmith |
| sequel, audrey, schedule, horses, goldsmith, training, raised, northern, california, riding, learnin g, worked, important, family, played, sisters, stable, facebook, instruction, dressage, hunters, jum pers |
| (SLD : skyview-farm.com) |
| Sports/Equestrian/Show_Jumping/Training_and_Facilities/United_States/California |
| zum Seitenanfang ↑ |
| 1UP |
| Urban Chaos: Riot Response Preview from 1UP.com |
| http://www.1up.com/do/previewPage?cId=3147847&did=1 |
| Preview, by Patrick Joynt: "There's something very refreshing about a game that goes to such lengths to have a player character who is totally un-conflicted and "in the right," but we'll see if the th is run-and-gun sequel adds any depth to its simplistic gameplay by its June release." |
| |
| |
| margin, response, twitter, action, bottom, shield, featuredblogs, police, gameplay, through, invite, character, mission, padding, friend, previews, previews, someone, height, community, molotov, cockt ails, shotgun, footage, development, particularly, border, medals, shooter, videos, features, cheats , battlefield, reviews, previews, sequel, posted, taking, enemies, around, holding, missions, compan y, modern, warfare, boards, really, burners, people, behind, interesting |
1up.com - rank der domain 8552 (3245 in US)
|
| Games/Video_Games/Action-Adventure/U/Urban_Chaos_Series/Urban_Chaos_-_Riot_Response |
| zum Seitenanfang ↑ |
| David Tanguay's Review |
| King's Quest II: Romancing the Throne |
| http://www.sentex.net/~datanguayh/games/kq2_rev.html |
| Rated -4 of -5 to +5 scale. "King's Quest II is nothing more than a sequel: an uninspired clone of t he original, another spin around the block for the game engine." |
| |
| |
| around, throne, romancing, before, challenges, graham, reviews, allusions, moderate, disjoint, solut ions, multiple, setting, various, required, legends, playful, segments, broken, little, although, re levant, obvious, objects, immediately, purpose, solution, evaluations, related, series, rationale, p eople, played, tanguay, nature, adventure, reviews, description, gobbledygook, recommended, single, nothing, sequel, object, points, general, however, uninspired, spoiler, ridden, beware |
sentex.net - rank der domain 214381 (3067 in CA)
|
|
| zum Seitenanfang ↑ |
| MTV Movie News: '300' Trivia: Albino Giants, Sequel Chances and Sienna Miller |
| '300' Trivia: Albino Giants, Sequel Chances — And Sienna Miller - Movie News Story | MTV Movie News |
| http://www.mtv.com/movies/news/articles/1554534/20070313/story.jhtml |
| Attention "300" fans: As you get your fix of Spartan glory, director Zack Snyder has 30 fun facts yo u might not know about the gruesome flick. By Josh Horowitz. |
| Attention "300" fans: As you get your fix of Spartan glory, director Zack Snyder has 30 fun facts you might not know about the gruesome flick. |
| mtv movie news story |
| inputtheme, miller, snyder, people, lsconf, movies, photos, keywords, movies, rodrigo, albino, reall y, watchmen, sienna, sitewide, charlie, function, policy, privacy, little, dialogue, undefined, chan ces, elephants, themes, document, 1554534, because, giants, videos, reviews, trivia, should, content , sequel, everyone, butler, gerard, battle, wanted, captain, sequence, paintings, million, drawing, overturelinkspots, overture, create, configuration, linkspots, object |
mtv.com - rank der domain 1126 (478 in US)
|
| Arts/Movies/Filmmaking/Directing/Directors/S/Snyder,_Zack |
| zum Seitenanfang ↑ |
| Infinity Plus: The Complete Roderick |
| John Sladek: The Complete Roderick - an infinity plus review |
| http://www.infinityplus.co.uk/nonfiction/roderick.htm |
| Richard Hammersley reviews Roderick and Roderick at Random. |
| Outstanding in small doses, but tiresome in the long haul ... it is not that the sequel is inferior to the original, but it is too much the same. |
| |
| roderick, novels, characters, sladek, infinity, comedy, robotics, people, example, misanthropic, ecc entric, generally, richard, nature, reviews, hammersley, social, fiction, published, devices, comple te, things, tiresome, because, rather, sequel, another, thoughts, feelings, particularly, hilarious, paragraphs, becomes, enough, points, modern, knowing, fashion, itself, course, milking, written, au thor, outstanding, overstatement, writing, aspect, straight, throughout, another, pompousness |
infinityplus.co.uk - rank der domain 986863 (6557 in UK)
|
| Arts/Literature/Genres/Science_Fiction/Authors/S/Sladek,_John |
| zum Seitenanfang ↑ |
| GameSpot |
| X-COM: Apocalypse Review for PC - GameSpot |
| http://www.gamespot.com/pc/strategy/xcomapocalypse/review.html |
| Review by Ron Dulin, [8.6] "This is almost the X-COM sequel that folks have been hoping for." |
| This is almost the X-COM sequel that folks have been hoping for. |
| X-COM: Apocalypse Review for PC, PC X-COM: Apocalypse Review, X-COM: Apocalypse Review, PC X-COM: Ap ocalypse, X-COM: Apocalypse for PC, X-COM: Apocalypse Article, X-COM: Apocalypse Hands On |
| apocalypse, imgelem, document, gamespot, combat, function, review, reviews, return, agents, geteleme ntbyid, script, player, itrkid, single, technology, instead, previous, equipment, cheats, connect, f acebook, score8, buildings, interactive, parentelem, primus, aliens, andreas, content, terror, reall y, almost, location, missions, interesting, interceptor, streets, between, summary, species, sports, college, reserved, showcase, cbsnews, cbsinteractive, researches, continue, studio, universe |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Strategy/Turn-Based/X-COM_Series/Apocalypse |
| zum Seitenanfang ↑ |
| WorldVillage |
| Riven: The Sequel to Myst |
| http://www.worldvillage.com/wv/gamezone/html/reviews/riven.htm |
| Rated 4/5 by Rich Cunningham. "If you are looking for a mentally stimulating, cerebrally challenging game that can leisurely be solved, then this is the game of the year for you." |
| ...... |
| err2 |
| worldvillage, reviews, document, software, function, opacity, getelementbyid, thefield, animate, bus iness, config, villages, recaptcha, submit, online, important, sequel, health, united, ckrating, fam ily, manchester, reviews, errorbox, celtic, pagetracker, season, savedbox, memphis, addloadevent, un defined, savedcomment, marketing, 11934033, typeof, required, wordpress, science, streaming, reveale r77, montana, hannah, slideup, background, download, episode, recently, article, gajshost, support, marketing |
worldvillage.com - rank der domain 136128 (52974 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Myst_Series/Riven/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| 'Creepers' sequel takes ugly turn |
| 'Creepers' sequel takes ugly turn / LJWorld.com |
| http://www2.ljworld.com/news/2003/aug/29/creepers_sequel_takes/ |
| A review by Jon Niccum. "If only Salva hadn't made the movie so emotionally ugly." |
| |
| |
| middot, comments, creepers, jeepers, inline, submit, creeper, ljworld, lawrence, popuplink, street, script, marketplace, douglas, county, district, document, widget, length, content, horror, advertise ment, shirtless, facebook, delicious, convicted, warning, friday, arrested, august, downtown, alterc ation, hardly, screen, services, basketball, scarecrow, cheerleaders, realize, basehor, symbolism, p redecessor, spread, inlines, before, tighter, premise, chaotic, sports, school, haskell |
ljworld.com - rank der domain 33863 (12504 in US)
|
| Arts/Movies/Titles/J/Jeepers_Creepers_Series/Jeepers_Creepers_2/Reviews |
| zum Seitenanfang ↑ |
| The Chrono Chronicles |
| The Chrono Chronicles - The Place for Chrono Trigger Fan Fiction |
| http://members.tripod.com/chrono_chronicles/ |
| Fan fiction, MIDI and archives. |
| You're about to enter one of the biggest growing Chrono Trigger Fan Fiction Sites on the Internet. This site is solely dedicated to one of the most successful Squaresoft Role Playing Games in histor y. With its great game play, special graphics, and intriguing storyline, Chrono Trigger has become like a legend hardcore and new gamers alike. And, its style makes it easy to play over and over, as there is no 'perfect' game. There should be a sequel. But there isn't. So, Gaspar, Belthasaur , and Melchoir have teamed up for the second best thing. An online sequel. You make the plot, and you decide what you want. But, you can also just turn in your own little sequel in our showcase. W e want you to have fun here, so go ahead, and continue one of the most capturing games on the SNES e ver. |
| Chrono, Trigger, Fan, Fiction, Standalone, Stand, Alone, Stories, Story, Interactive, BC, Ayla, Gas par, Melchoir, Belthasaur, Ozzie, Slash, Epoch, Future, Past, Squaresoft, SNES, Super, Nintendo, Ent ertainment, System, Inc, Incorporated, Elvin, Fortuna, Andrew, Ingle, Stephen, Fong |
| background, height, social, images, position, repeat, important, window, search, container, margin, document, button, padding, display, jquery, tripod, chrono, category, decoration, function, section, onbutton, adbanner, relative, documentelement, sprite, onshare, onsearch, animate, sequel, hidden, center, chronicles, contact, trigger, clientwidth, setforcedparam, normal, return, gaspar, clienthei ght, replace, contain, chronicles, pointer, helvetica, melchior, family, cursor, belthasaur |
tripod.com - rank der domain 845 (44 in JP)
|
| Games/Video_Games/Roleplaying/C/Chrono_Series/Chrono_Cross |
| zum Seitenanfang ↑ |
| TeenHollywood.com: Jessica Biel - Classic Horror Queen |
| Jessica Biel: Classic Horror Queen - TeenHollywood.com |
| http://www.teenhollywood.com/d.asp?r=50498 |
| An interview with Lynn Barker. |
| After her long stint as a minister's daughter on t.v.'s "7th Heaven", Jessica Biel has bee n working virtually non-stop in feature film. She is now shooting a sequel to the vampire actioner Blade with Wesley Snipes and has learned how to "slit a bad guy's throat with a credit card!&qu ot;. In theaters Friday, find Jessica in the re-make of the horror classic that launched them all, Texas Chainsaw Massacre (a sequel of which introduced Renee Zellweger and Matthew McConaughey). When we chatted with the hot actress, she was very open about her career choices, putting finishing coll ege on hold, how she spends her down time and she admits that she's not a wild party girl but gettin g Punk'D might be fun!. |
| |
| jessica, teenhollywood, really, undefined, typeof, character, something, people, thought, chainsaw, heaven, little, massacre, getting, always, pretty, document, 10000000000000000, random, different, w orking, original, anything, wanted, tucker, marcus, process, leather, seventh, outfit, sequel, chara cters, strong, because, enjoying, history, through, credit, throat, change, taxing, probably, allowi ng, chapstick, course, usually, wouldn, having, trying, family, scenes |
teenhollywood.com - rank der domain 56379 (21430 in US)
|
| Arts/Performing_Arts/Acting/Actors_and_Actresses/B/Biel,_Jessica |
| zum Seitenanfang ↑ |
| IMDb - Urban Legends: The Final Cut (2000) |
| Urban Legends: Final Cut (2000) |
| http://us.imdb.com/title/tt0192731/ |
| Cast/credits plus additional information about the film |
| Directed by John Ottman. With Jennifer Morrison, Matthew Davis, Hart Bochner. Urban legend-style ki llings begin to occur on a movie set, in this non-sequel sequel to "Urban Legend". Visit I MDb for Photos, Showtimes, Cast, Crew, Reviews, Plot Summary, Comments, Discussions, Taglines, Trail ers, Posters, Fan Sites |
| Reviews, Showtimes, DVDs, Photos, Message Boards, User Ratings, Synopsis, Trailers, Credits |
| tabular, videos, imdbpro, background, generic, falltvpreviewdiv, margin, rto2010navstripe, legends, movies, border, family, iframe, verdana, episodes, amazon, heading, monitoring, classname, eeeeee, s howtimes, crewcompany, creditstv, sequel, legend, summarysynopsisplot, reviewsnewsgroup, travis, rat ingsparents, guiderecommendationsmessage, campus, reviewsawardsuser, spoiler, hasvoted, visited, pre view, keyword, keywordsamazon, window, function, detailscombined, linksbox, channel, reviews, rating , boards, thumbs, richard, awards, overview, alpine |
imdb.com - rank der domain 47 (25 in US)
|
| Arts/Movies/Titles/U/Urban_Legend_Series/Urban_Legends_-_Final_Cut |
| zum Seitenanfang ↑ |
| Wikipedia: The Dark Knight |
| The Dark Knight (film) - Wikipedia, the free encyclopedia |
| http://en.wikipedia.org/wiki/Untitled_Batman_Begins_Sequel |
| Superhero film sequel based on the fictional DC Comics character Batman. |
| |
| |
| batman, retrieved, knight, ledger, december, august, gotham, movies, article, begins, articles, gord on, million, chicago, january, october, february, record, harvey, november, september, eckhart, knig ht, warner, wikipedia, company, release, entertainment, united, christopher, entertainment, office, character, american, original, opening, reporter, hollywood, michael, academy, corporation, superman , action, archive, variety, variety, sequel, released, theaters, movies, filming |
wikipedia.org - rank der domain 6 (5 in US)
|
| Arts/Movies/Titles/B/Batman_Series/Dark_Knight,_The |
| zum Seitenanfang ↑ |
| Gamebits |
| Chrono Cross | Gamebits |
| http://www.gamebits.net/psx/ccross.shtml |
| "The time-travelling most players will be doing is remembering the original game, which the sequel f ails to live up to." Review by Ken Gagne with rating [7.4]. |
| |
| chrono cross,psx,square electronic arts l.l.c. |
| chrono, january, november, august, october, february, december, september, square, battle, nintendo, playstation, characters, trigger, gamebits, document, system, points, script, without, colors, sequ el, another, competition, unique, rating, function, 2242257, twilight, eclipse, spells, reserved, ri ghts, donkey, battle, future, before, horrible, conclusion, choose, adventure, attacks, gamebits, co mments, travelling, dungeon, addloadevent, reviews, electronic, players, simpler |
| (SLD : gamebits.net) |
| Games/Video_Games/Roleplaying/C/Chrono_Series/Chrono_Cross/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| It's Over |
| index |
| http://itsover.20m.com |
| A rejected script for a sequel to Fight Club. |
| |
| |
| border, 000099, background, family |
20m.com - rank der domain 34501 (12794 in US)
|
| Arts/Movies/Filmmaking/Screenwriting/Scripts/Unproduced |
| zum Seitenanfang ↑ |
| Texas Chainsaw Massacre: The Next Generation |
| Texas Chainsaw Massacre: The Next Generation |
| http://www.angelfire.com/ga4/tcm4/index.html |
| A fansite with pictures, information, reviews, FAQ, interviews, forum, multimedia, and links. |
| A website dedicated to the horror sequel. Site includes images, reviews, plot, multimedia, interview s, and much more. |
| Texas Chainsaw Massacre: The Next Generation, Return of Texas Chainsaw Massacre, Kim Henkel, Renee Z ellweger, Texas Chainsaw Massacre, Horror, Cult, Texas Chainsaw Massacre sequel, Texas Chainsaw Mass acre 4 |
| guestbook, footage, reviews, picture, multimedia, gallery, interviews, updates, characters, quotes, generation, chainsaw, massacre, website, updated, officially, viewable |
angelfire.com - rank der domain 1912 (770 in US)
|
| Arts/Movies/Titles/T/Texas_Chainsaw_Massacre_Series/Texas_Chainsaw_Massacre_-_The_Next_Generation |
| zum Seitenanfang ↑ |
| The Ferris Bueller Page [idiotsavant.com] |
| The Ferris Bueller Page |
| http://www.idiotsavant.com/bueller/ |
| The unofficial site with pictures, sounds and information. Drop by and speculate on the sequel |
| the unofficial site with pictures, sounds and information. Drop by and speculate on the sequel. |
| ferris bueller,ferris bueller's day off,ferris buellers day off,ferris bueler's day off,ferris beull er's day off,ferris buelers day off,ferris,ferris buller's day off,ferris bueller sounds,ferris buel ler soundtrack,ferris beuler's day off,ferris day off,bueller,ferris buehler's day off,ferris buelle r's day off soundtrack,ferris beullers day off,ferris bulers day off,ferris beulers day off,matthew broderick,ferris+bueller,ferris buler's day off,danke shoen,ferris bueller's day off sounds,jennifer grey,ferris bueller quotes,ferarri,ferris buhler's day off,movie sounds,dream academy,ferris buelle r wav,ferris bueller day off,ami dolenz,ferris buellers day off,ferris bueller script,charlie schlat ter,ferris bueller pictures,computer,bueller,ferris bueller wavs,ferris buellar's day off,ferris bue ller's,day off,ferrari,mathew broderick,ferris buellers day off sounds,the english beat,soundtrack,f erris bueller metasearch,ferris beuhler's day off |
| ferris, bueller, broderick, matthew, chicago, working, downtown, another, college, information, addi tional, pictures, idiotsavant, miller, miller, storyline, summary, paramount, created, fifteen, sequ el, returns, speculate, featuring, directed, starring, hughes, suggestions, comments, follow, castin g, remember, become, edward, rooney, problem |
idiotsavant.com - rank der domain 922788 (0 in CA)
|
|
| zum Seitenanfang ↑ |
| Tron Sector |
| Tron Sector - Dedicated to the TRON movie, the upcoming TRON:Legacy sequel, and the whole TRON universe! |
| http://www.tron-sector.com/ |
| Dedicated to the movie, game, and film sequel. Features forum, news, gallery, music, and sounds. |
| |
| |
| legacy, original, worldoutwest, released, soundtrack, arcade, building, sector, upcoming, sinistar, westthe, disney, interview, center, release, deluxe, events, arcade, december, actual, future, quorr a, california, celebrate, appeared, series, lightcycle, considered, located, exciting, cycles, exter ior, action, programs, circuit, 2010re, created, iconic, legacy, promotional, revealed, various, tra nsport, surround, reveals, cycles, happen, computer, location, warner, arcade |
tron-sector.com - rank der domain 973801 (378111 in US)
|
| Arts/Movies/Titles/T/Tron_Series/Tron |
| zum Seitenanfang ↑ |
|
Sitemap.XML / Sitemap.HTML / search / Kontakt & Impressum / Domains
