| Upstream Newspaper |
| The International Oil & Gas Newspaper |
| http://www.upstreamonline.com |
| A weekly exploration and production related newspaper, covering global issues, supported with a dail y internet service. |
| |
| |
| newspaper, international |
upstreamonline.com - rank der domain 160469 (62402 in US)
|
| Business/Energy/Oil_and_Gas/News_and_Media |
| zum Seitenanfang ↑ |
| The Virginia Newspaper Project |
| Library of Virginia Newspaper Project |
| http://www.lva.lib.va.us/whatwedo/vnp/index.htm |
| Located at the Library of Virginia, the goal of the Virginia Newspaper Project is to locate, invento ry, catalog, and preserve the valuable newspaper resources housed in repositories throughout the Com monwealth. Much useful information about Virginia's newspaper history. |
| |
| |
| padding, relative, position, bottom, website, leftside, margin, virginia, library, newspaper, projec t, rightside |
| (SLD : va.us) |
| Regional/North_America/United_States/Virginia/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| newspaper |
|
|
| newspaper |
| zum Seitenanfang ↑ |
| Asian Pages Newspaper |
| Asian Pages Newspaper |
| http://www.asianpages.com |
| Provides information on this newspaper. Also gives news on finance, education, arts, immigration, cl assifieds, books, and short stories. |
| |
| |
| browser, support, frames, newspaper |
| (SLD : asianpages.com) |
| Society/Ethnicity/Asian/Asian-American/News_and_Media |
| zum Seitenanfang ↑ |
| ਪਰਵਾਸੀ ਵੀਕਲੀ |
| Parvasi : punjabi newspaper (Mehra Media) - Home |
| http://www.parvasi.com |
| ਵੀਕਲੀ ਪਤਰਿਕਾ ਜੋ ਖਬਰਾਂ ਪ੍ਰਕਾਸ਼ਿਤ ਕਰਦੀ ਹੈ । |
| newspaper, newspapers, punjabi newspaper, punjabi newspapers, jalandhar, punjab, india, newspaper ja landhar, newspaper punjab, newspaper india |
| newspaper, newspapers, punjabi newspaper, punjabi newspapers, jalandhar, punjab, india, newspaper ja landhar, newspaper punjab, newspaper india |
| monthsofyear, daysofweek, document, digital, clockupdate, script, advanced, myfont, padding, window, function, display, needed, version, display, available, seconds, astroboy, layers, configuration, u pdated, minutes, version, friday, august, margin, january, february, saturday, example, change, valu es, following, arrays, contain, months, leftcol, tuesday, wednesday, monday, sunday, wanted, abbrevi ated, september, thursday, getday, newspaper, getdate, getmonth, return, clockposns |
| (SLD : parvasi.com) |
| World/Punjabi_Gurmukhi/ਖ਼ਬਰਾਂ |
| zum Seitenanfang ↑ |
| newspaper |
|
|
| newspaper |
| zum Seitenanfang ↑ |
| Bellingham Bulletin |
| Bellingham Bulletin, the feel-good newspaper for Bellingham, Massachusetts |
| http://www.bellinghambulletin.com/ |
| Monthly hometown newspaper providing local advertising and information from town and school official s, business and civic and cultural organizations. |
| Bellingham Massachusetts' favorite hometown newspaper is free! |
| Bellingham MA newspaper, Bellingham Bulletin, hometown news, Bellingham news, monthly newspaper, fre e newspaper, advertising, travel, businesses, home & garden, lifestyle, food, top headlines, indepen dent newspaper, direct mailed, women |
| bellingham, massachusetts, window, widget, bulletin, newspaper |
| (SLD : bellinghambulletin.com) |
| Regional/North_America/United_States/Massachusetts/Localities/B/Bellingham |
| zum Seitenanfang ↑ |
| The Scioto Voice Newspaper |
| The Scioto Voice Newspaper |
| http://www.thesciotovoice.com/ |
| Weekly newspaper covering news, sports, and legal notices in Scioto county. |
| |
| |
| newspaper, scioto, online, available, locally, operated, delivered, proudly, advertisers, readers, s erving |
| (SLD : thesciotovoice.com) |
| Regional/North_America/United_States/Ohio/Localities/W/Wheelersburg/News_and_Media |
| zum Seitenanfang ↑ |
| The Navigator |
| the Navigator Newspaper : Vancouver Island University : Nanaimo, BC |
| http://www.thenav.ca/ |
| Biweekly of Vancouver Island University. |
| The Navigator is Vancouver Island University's student newspaper. |
| The Navigator, the Navigator newspaper, VIU's newspaper, the Nav, student newspaper, university news paper, student press Vancouver Island, Vancouver Island University's newspaper, Malaspina University newspaper, Nanaimo newspaper, Vancouver Island newspapers |
| editor, navigator, newspaper, marijuana, rachelle, design, crosby, working, wotten, robichaud, paget racker, virtual, enjoyed, document, island, gajshost, vancouver, university, nanaimo, cannabis, conv ention, scotland, itself, musically, project, upcoming, hoodikoff, sports, excited, moments, carnous tie, weapon, zombies, devour, biological, nuclear, bombers, yonder, cacophany, honesty, coward, chri stopher, arruda, releasing, seiben, stacey, vocals, popular, parachute, klassen, liliana |
| (SLD : thenav.ca) |
| News/Colleges_and_Universities/Newspapers/Canada/British_Columbia |
| zum Seitenanfang ↑ |
| Small Town Newspaper |
| Small Town Newspaper-A newspaper directory featuring small town newspapers and articles. |
| http://www.smalltownpapers.com/ |
| Directory of newspapers for small towns. Newspapers are scanned in. |
| Small Town Newspaper is an online newspaper directory catering to small town archives and local news paper readers |
| newspaper, online newspaper, archive, newspaper article, genealogy, local newspaper, history, town, small town, new paper article, weekly newspaper, family tree, weekly news papers, small town newspa per |
| county, journal, herald, valley, gazette, record, iowathe, minnesotathe, dakotathe, reporter, tribun e, independent, washingtonthe, texasthe, enterprise, virginiathe, kansasthe, californiathe, review, idahothe, athens, border, oregonthe, margin, arizonathe, weekly, springs, pioneer, oklahomathe, smal ltownpapers, illinoisthe, alabamathe, wyomingthe, superior, citizen, standard, padding, spring, caro linathe, montanathe, issaquah, george, newspaper, manuel, sentinel, radius, american, democrat, rapi ds, munday, conway |
smalltownpapers.com - rank der domain 771142 (312976 in US)
|
| News/Newspapers/Directories/United_States |
| zum Seitenanfang ↑ |
| Able Newspaper On-line |
| ABLE NEWSPAPER - A DISABILITY NEWSPAPER -news for people with
disabilities, disabled, advocacy news |
| http://ablenews.com |
| A monthly newspaper that is published for, by and about the disabled. |
| |
| |
| newspaper, disability, rights, newspaper, disabled, disabilities, advocacy, navigating, accessibilit y, handicaped, bottom, website, frames, content, accessible, browsers, ablenews, directory, business , subscriptions, archives, bookmark, movement, current, issues, jersey, island, positively, disabled , disability, people, disability, sports, legislation, employment, quality, leaders, biographys, acc essibility, articles, edition, subjects, newspaper |
| (SLD : ablenews.com) |
| Society/Disabled/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| Newspaper Telemarketing Specialist |
| Newspaper Telemarketing for Circulation |
| http://totalmarketingoutbound.com |
| Specializes in providing telemarketing services for newspapers throughout the United States. |
| Ciculation telemarketing. Newspaper Telemarketing Specialist. Newspaper subscription acquistion. |
| |
| landmark, responsibility, circulation, community, weekly, execute, subscription, campaign, fantastic , acquisition, reserved, rights, harris, teleservices, washington, handle, newspaper, representative , customer, speaks, circulation, telemarketing, newspaper, tuesday, operator, places, virginia, news papers, whether, fredericksburg, choose, center, offices, seriously |
| (SLD : totalmarketingoutbound.com) |
| Business/Marketing_and_Advertising/Telemarketing |
| zum Seitenanfang ↑ |
| The Newspaper Guild |
| The Newspaper Guild |
| http://www.newsguild.org/ |
| A Sector of the Communications Workers of America representing newspaper workers. |
| Home page for The Newspaper Guild, Communications Workers of America, The Newspaper Guild, TNG, CWA, The Guild Reporter |
| Newspaper union, union contracts, The Newspaper Guild, The Guild Reporter, TNG, CWA |
| communications, stories, newspaper, huffington, wednesday, ownership, profit, content, rights, journ al, current, chairman, journalismreview, genachowski, administration, democrat, quarter, operating, advertising, huffpo, internet, newspaper, employees, previous, commission, federal, workers, journal ism, program, calendar, sexual, contracts, contact, harassment, america, border, rights, mission, or ganize, ntilde, washington, listen, arianna, sections, anyone, street, politics, inched, workersof, launching, closer |
newsguild.org - rank der domain 892601 (382210 in US)
|
| Regional/North_America/United_States/Society_and_Culture/Labor/Communications_Workers_of_America_-_CWA |
| zum Seitenanfang ↑ |
| The Plain Dealer |
| Cleveland Plain Dealer Newspaper - Largest Ohio Newspaper |
| http://www.plaindealer.com/ |
| Daily newspaper for the greater Cleveland area. |
| The Plain Dealer, Cleveland, Ohio. Get today's news, classifieds and sports. Advertise and Subscri be. |
| cleveland newspaper, ohio newspaper, plain dealer, newspaper advertising, CLEVELAND NEWSPAPER, OHIO NEWSPAPER, PLAIN DEALER, NEWSPAPER ADVERTISING |
| download, dealer, shockwave, cleveland, newspaper, coverage, exclusively, complete, estate, sports, careers, newsroom, contact, newspaper, subscribe, information, subscribe, advertise, contact, advert ising, plaindealer, classifieds, affiliated, version, swflash, height, largest, cleveland, runconten t, macromedia, codebase, absmiddle, shockwaveflash, exclusively, classifieds, version, quality, plug inspage |
plaindealer.com - rank der domain 298557 (117845 in US)
|
| Regional/North_America/United_States/Ohio/Localities/C/Cleveland/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| The STAR |
| The STAR - Belizean Newspaper |
| http://star.belizeanlife.com/ |
| Offers a profile of the newspaper and downloadable PDF files of current and archived editions. |
| The Star is a Belizean independent weekly community-based Newspaper |
| |
| expatbelize, subscription, sample, website, belizean, newspaper, location, document |
| (SLD : belizeanlife.com) |
| Regional/Central_America/Belize/News_and_Media |
| zum Seitenanfang ↑ |
| Exeposé |
|
| http://xmedia.ex.ac.uk/newspaper/ |
| Weekly student newspaper of the University of Exeter. |
| |
| |
| default, themes, import, r1241860259, newspaper, content, handheld, r1206954990, screen, online, exe pos, layout, eacute, r1254567131 |
| (SLD : ac.uk) |
| Reference/Education/Colleges_and_Universities/Europe/United_Kingdom/England/University_of_Exeter |
| zum Seitenanfang ↑ |
| Eagle Eye Newspaper |
| Eagle Eye Newspaper |
| http://www.wjcc.k12.va.us/jhs/Student/CLUBS/Eagle_Eye/INDEX.html |
| Student newspaper. View history of publication and latest edition. |
| |
| |
| newspaper, history, members, disclaimer, release, official, resources, online, online, design |
| (SLD : va.us) |
| Regional/North_America/United_States/Virginia/Localities/J/Jamestown/Education |
| zum Seitenanfang ↑ |
| East Surrey Talking Newspaper |
| East Surrey Talking Newspaper | East Surrey Talking Newspaper |
| http://www.estna.btik.com/ |
| Produced once a fortnight by a group of local volunteers delivered to people with a visual impairmen t in East Surrey. |
| Providing fortnightly audio tapes of local news to those who are registered blind or partially-sight ed in the Borough of Reigate & Banstead |
| Talking Newspaper, Registered Blind, Reigate&Banstead, East Surrey Talking Newspaper, Ann Wilson, Ea st Surrey, Reigate Talking Newspaper, Redhill Talking Newspaper, Horley Talking Newspaper, Banstead Talking Newspaper, Merstham Talking Newspaper, Surrey Talking Newspaper |
| talking, newspaper, surrey, reigate, borough, banstead, 270757, secretary, recipients, enquiries, ho norary, wilson, powered, sighted, partially, builder, website, community, registered, ntlworld, wils on, residents, welcome, registered, enquiry, comments, association, listeners, partially, sighted, i nterest, general, fortnightly, provide |
| (SLD : btik.com) |
| Regional/Europe/United_Kingdom/England/Surrey/Society_and_Culture/Disability_Resources |
| zum Seitenanfang ↑ |
| AllYouCanRead.com |
| AllYouCanRead.com - The World's Largest Online Newsstand - 28,000 Newspapers and Magazines from 200 Countries |
| http://www.allyoucanread.com/ |
| Searchable directory of magazines and newspapers from over 180 countries. |
| AllYouCanRead is a massive media directory of 22,800 local and international magazines and newspaper s from all over the world. |
| magazine, newspaper, magazines, newspapers, news paper, magazine subscriptions, magazine subscriptio n, newspaper articles, times newspaper, daily newspaper, newspaper subscriptions, home magazine, lif e magazine, sun newspaper, health magazine, magazine articles, newspaper article, online magazine, p c magazine, business magazine, free magazine, free magazines, herald newspaper, star magazine, star newspaper, fitness magazine, local newspaper, online newspaper, times magazine, car magazine, fashio n magazine, newspaper archives, online newspapers, science magazine, state newspaper, tribune newspa per, california newspaper, illinois newspaper, mens magazine, music magazine, newspaper obituaries, virginia newspaper, online magazines, oregon newspaper, alabama newspaper, courier newspaper, dallas newspaper, gazette newspaper, local newspapers, sentinel newspaper, teen magazines, wisconsin newsp aper, daily newspapers, jacksonville newspaper |
| allyoucanread, islands, magazines, philippines, business, newspapers, magazines, design, business, d egrees, health, health, online, computer, computer, education, newspapers, programs, security, engin eering, management, sports, marketing, virgin, degree, entertainment, international, nursing, fashio n, travel, technology, science, republic, france, tobago, american, guinea, management, manila, phil ippine, georgia, carolina, mexico, pakistan, dakota, illustrated, travel, engineering, netherlands, science, education |
allyoucanread.com - rank der domain 48945 (18482 in US)
|
| News/Directories |
| zum Seitenanfang ↑ |
| A & E Manufacturing |
| Newspaper Holders Residential Mailboxes Newspaper Boxes from A and E Manufacturing in Canada |
| http://www.newspaperholder.ca/ |
| Offers a mountable newspaper holder. |
| Our Newspaper holders are a convenient, durable and weatherproof place for your daily newspaper deli very. |
| newspaper holders, residential mailboxes, newspaper boxes, newspaper holder, delivery box, decorativ e mailbox, rural mail box, custom mailboxes, letter box, A&E Manufacturing, Prince George, BC, Canad a |
| newspaper, newspaper, holders, mailboxes, manufacturing, acrylic, durable, serviced, canada, deliver y, residential, construction, newspaper, holder, install, contractors, realtors, special, building, people, promotional, summer, security, products, privacy, designs, design, copyright, s14bompas, col umbia, british, george, prince, newspaperholder, attractive, patented, apartment, communal, solution , decorative, condition, readable, testimonial, mailboxes, holders, residential, prompt, service, de lighted, appearance, victoria |
| (SLD : newspaperholder.ca) |
| Shopping/Home_and_Garden/Accessories |
| zum Seitenanfang ↑ |
| Χαραυγή |
| Haravgi Cyprus No.1 Quality Newspaper Website Haravgi Newspaper, top cyprus newpaper, cyprus latest news and articles, cyprus newspaper. |
| http://www.haravgi.com.cy/ |
| Καθημερινή εφημερίδα με πολιτικές, κοινωνικές, οικονομικές και αθλητικές στήλες. |
| '. |
| 'Haravgi Newspaper, top cyprus newpaper, cyprus latest news and articles, cyprus newspaper. |
| window, cyprus, newspaper, sidebar, haravgi, website, quality, cyprus, external, addpanel, return, a ddfavorite, haravgi, articles, latest, newpaper, newspaper, function, createbookmarklink |
| (SLD : com.cy) |
| World/Greek/Κατά_Περιοχή/Μέση_Ανατολή/Κύπρος/Ειδήσεις_και_ΜΜΕ |
| zum Seitenanfang ↑ |
| Bona Fide Classified |
| NewsVoyager.com |
| http://bonafideclassified.com/ |
| A service of the Newspaper Association of America, gateway to nearly all US newspaper classified adv ertising online. |
| NewspaperLinks.com, hosted by the Newspaper Association of America, is the official gateway to local newspaper sites on the Web. |
| NAA, NewspaperLinks, NewspaperLink, Newspaper Links, Newspaper Link, Newspaper |
| newspapers, newspaper, listbox, document, virginia, dakota, weekly, carolina, stateid, wisconsin, wa shington, vermont, tennessee, wyoming, pennsylvania, mexico, jersey, hampshire, nevada, oregon, okla homa, island, technical, webmaster, association, privacy, policy, reserved, rights, america, contact , please, information, ccffff, nebraska, assistance, louisiana, international, college, canadian, ar chives, groups, organizations, associations, netscape, selectedindex, submitform, function, newsvoya ger, action, submit |
| (SLD : bonafideclassified.com) |
| Business/Marketing_and_Advertising/Advertising/News_and_Media/Newspaper |
| zum Seitenanfang ↑ |
| The Wake Weekly Web Site |
| Welcome to the Wake Weekly Online Edition |
| http://www.wakeweekly.com/ |
| Wake Forest's weekly newspaper. |
| Welcome to The Wake Weekly on the World Wide Web where you'll find the top stories for northern Wake and Franklin counties, including Wake Forest, Rolesville, Youngsville and Franklinton, updated each week. |
| Wake Forest, Wake Forest NC, Wake Forest Newspaper, Newspaper, Weekly Newspaper, Wake Forest News, W ake Forest Newspaper, Wake Forest Weekly Newspaper |
| education, government, classifieds, community, newsstands, legals, contact, advertise, welcome, week ly, breaking, edition, online, subscribe |
| (SLD : wakeweekly.com) |
| Regional/North_America/United_States/North_Carolina/Localities/W/Wake_Forest/News_and_Media |
| zum Seitenanfang ↑ |
| India Classifieds |
| India Classifieds,newspaper advertising, newspaper ads, India Classified, classifieds india, indian classifieds - Place classified newpaper ads in any Indian newspaper or place free classifieds for India. Newspaper classifieds, ad classifieds, newspaper classifieds ads, Free India Classfieds. Free online classifieds. Post free classified ad |
| http://www.indiaclassifieds.com/ |
| Offer insertion of advertisements directly from the internet into any Indian print media. |
| Place classified newspaper ads in any Indian newspaper. Also place free classified ad. Free India Cl assified, Free India classifieds. |
| india classifieds,india classified, indian classifieds, newspaper ads, newspaper classifieds, newspa pers classifieds, newspaper advertiser, ad classifieds, newspaper advertising, classifieds ads, clas sifieds advertising, newspaper advertiser, classifieds india, free india classifieds, free classifie d, free classifieds, classifieds in India, indianclassifieds, free indian classifieds, classifieds f or indians, india-classified, india-classifieds, indiaclassifieds, classified, india classifieds, cl assifieds, nri, nris, india, indian, indians, asia, asian, free classifieds india, free classifieds in India, free local classified ads, free classifieds india, free indian classified ad, classifieds site |
| classifieds, newspaper, homepage, classified, newpaper, online, classfieds, indian, newspaper, redir ect, location, function, mohite, author, mahesh, calledfrom, mainsite, classified, advertising, clas sifieds, indian |
indiaclassifieds.com - rank der domain 172779 (5611 in IN)
|
| Regional/Asia/India/Business_and_Economy/Classifieds |
| zum Seitenanfang ↑ |
| Laprensa Newspaper |
| |
| http://www.laprensatoledo.com |
| Weekly newspaper serving the Latino and Hispanic communities in Ohio and Michigan. |
| La Prensa is a Latino Newspaper and Hispanic Newspaper covering current Latino events in Ohio and Mi chigan |
| |
| |
laprensatoledo.com - rank der domain 169416 (65961 in US)
|
| Regional/North_America/United_States/Ohio/Localities/T/Toledo/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| Salado Village Voice |
| Salado Village Voice newspaper is Salado, Texas' newspaper for 30 years and counting |
| http://www.saladovillagevoice.com/ |
| Weekly community newspaper with local news, classifieds, and special publications. |
| Salado Village Voice is the newspaper for Salado, Texas. It is published weekly. This is the website for the Salado Village Voice. |
| Salado Village Voice, Village Voice, Salado newspaper, Salado sports, Salado news |
| salado, advertising, newspaper, village, newspaper, wedding, engagement, editor, sports, obituaries, calendar, events, classifieds, estate, record, letter, sections, counting, deadlines, classified, s ubmit, policies, package |
| (SLD : saladovillagevoice.com) |
| News/Newspapers/Regional/United_States/Texas |
| zum Seitenanfang ↑ |
| Historical Newspaper Index - Fairfax, VA |
| Using the Historical Newspaper Index - FCPL |
| http://www.fairfaxcounty.gov/library/virginia/varoom/newsindx/ |
| Index of newspaper records available at Fairfax County Library. Includes lists of Civil War veterans and civic leaders. |
| |
| |
| newspaper, historical |
fairfaxcounty.gov - rank der domain 26827 (9934 in US)
|
| Regional/North_America/United_States/Virginia/Society_and_Culture/Genealogy |
| zum Seitenanfang ↑ |
| The Bocas Breeze Newspaper |
| The Bocas Breeze Newspaper: News and info about Bocas del Toro Panama. :: bocas breeze newspaper, bocas del toro newspaper, p... |
| http://www.thebocasbreeze.com |
| Free monthly newspaper features community issues, events, and area businesses. |
| |
| bocas breeze newspaper, bocas del toro newspaper, panama newspaper, bocas del toro advertising, pana ma advertising, bocas del toro news, panama news |
| element, bubbling, bocasbreeze, window, return, expression, addeventlistener, urchintracker, informa tion, document, current, replace, ithappened, newspaper, articles, attachevent, photos, breeze, addl istener, function, panama, monthly, article, written, seasonal, spanish, submissionsfeel, published, english, lionfish, circulation, 2151389, suggestions, volume, permission, letters, 2010july, manage r, advertising, johnson, copyright, blaker, allene, editor, recent, articles, medium, 1stchoiceecomm erce, management, sitemap, website |
| (SLD : thebocasbreeze.com) |
| Regional/Central_America/Panama/Localities/Bocas_del_Toro |
| zum Seitenanfang ↑ |
| How to Create a Great Newspaper Advertisement |
| Newspaper Advertising Secrets |
| http://www.greatnewspaperads.com/ |
| A step by step guide on how to create a newspaper advertisement. |
| Newspaper Advertising Secrets - Sell More With Ads That Work Their Socks Off |
| newspaper advertising, secrets, create, write, ads, advertise, secrets, create, write, ads |
| newspaper, advertising, marketing, function, return, business, sample, advertising, sample, replace, create, string, newspaper, results, guarantee, getting, report, bottom, exactly, 339384, yourself, urchintracker, report, regexp, fromcharcode, tostring, glossary, absolutely, current, discover, thro ugh, putting, together, profit, easily, course, quickly, download, instructions, passwords, secrets, chance, success, producing, increase, profits, classified, checklist, contact, forget, affiliates |
greatnewspaperads.com - rank der domain 976652 (419494 in US)
|
| Shopping/Publications/Digital/Business/Marketing/Specific_Titles |
| zum Seitenanfang ↑ |
| Pacific Northwest Newspaper Guild |
| |
| http://www.nwguild.org/ |
| Union representing newspaper workers in Washington state. Local 37082 of the Newspaper Guild-Communi cations Workers of America. |
| |
| |
| |
| (SLD : nwguild.org) |
| Regional/North_America/United_States/Washington/Society_and_Culture/Labor |
| zum Seitenanfang ↑ |
| El Popular |
| El Popular Newspaper |
| http://www.elpopular.com/ |
| Periódico de Miami. Información de noticias locales y temas relacionados a la inmigración y entreten imiento. |
| El Popular Newspaper |
| |
| newspaper, popular |
| (SLD : elpopular.com) |
| World/Español/Regional/América/Estados_Unidos/Estados/Florida/Noticias_y_medios/Periódicos |
| zum Seitenanfang ↑ |
| The Newspaper Guild |
| The Newspaper Guild |
| http://www.newsguild.org/ |
| A Sector of the Communications Workers of America representing newspaper workers. |
| Home page for The Newspaper Guild, Communications Workers of America, The Newspaper Guild, TNG, CWA, The Guild Reporter |
| Newspaper union, union contracts, The Newspaper Guild, The Guild Reporter, TNG, CWA |
| stories, rights, current, newspaper, harassment, communications, sexual, program, workers, america, contracts, journalismreview, rights, organize, mission, calendar, ntilde, contact, border, poynter, archives, romenesko, useful, wikipedia, sitemap, american, columbia, chainlinks, stories, workersof, guildcommunications, washington, street, style3, noborder, style1, center, style2, information, mes sage, president, history, organizing, eguity, information, recent, organize, boxborder, statement, a rchives, outline |
newsguild.org - rank der domain 892601 (382210 in US)
|
| Regional/North_America/Canada/Society_and_Culture/Labour/Communications_Workers_of_America_-_CWA |
| zum Seitenanfang ↑ |
| Town-Crier Online |
| The Town-Crier Newspaper |
| http://www.gotowncrier.com/ |
| Updated local and regional news. |
| Newspaper Serving Wellington, Royal Palm Beach, Loxahatchee & The Acreage |
| |
| window, widget, newspaper |
| (SLD : gotowncrier.com) |
| Regional/North_America/United_States/Florida/Localities/W/Wellington/News_and_Media |
| zum Seitenanfang ↑ |
| The Aurora Newspaper |
| The Aurora Newspaper - 14 Wing Greenwood |
| http://www.auroranewspaper.com/ |
| The weekly newspaper of 14 Wing of Greenwood presents articles of interest to the wing, community an d those interested in Air Force matters. Lists issues and articles, advertising and military news li nks. |
| |
| |
| promotions, welcome, health, winter, carnival, aurora, newspaper, greenwood, fitness, centre |
| (SLD : auroranewspaper.com) |
| Regional/North_America/Canada/Nova_Scotia/Localities/G/Greenwood |
| zum Seitenanfang ↑ |
| Alraya Newspaper - Qatar, Gulf and World News |
|
| http://www.raya.com/ |
| Alraya Newspaper, Daily Arabic newspaper published in Qatar |
| |
| |
| |
raya.com - rank der domain 32893 (10 in QA)
|
| Regional/Middle_East/Qatar/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| US Newspapers |
| Newspaper Advertising | Nationwide Classified or Display Ads Cheap |
| http://www.usnewspapers.com/ |
| Classified and display ads available. Also specialized in negotiating stand-by space offers, custom newspaper buys, free-standing inserts. |
| Newspaper advertising statewide to nationwide. Classified advertising and display advertisements at affordable rates. Mass advertising programs available on a regional, statewide, or nationwide basis. |
| newspaper advertising, advertising ideas, newspaper classifieds, classified advertising, classified newspaper advertising, print advertising, advertise newspaper, newspaper advertisements, cost of new spaper ads, print media advertisement, display advertising, mass marketing, mass advertising, advert ising agency, marketing agency, ad agency |
| advertising, classified, display, advertising, newspaper, newspapers, newspaper, program, archive, c omplete, article, results, display, business, customers, campaign, states, marketing, classified, st atewide, marketing, budget, statewide, contact, sample, service, allows, guidelines, description, av ailable, pricing, newspapers, successful, magazine, recipes, secret, should, audience, connected, ad vertisers, section, generally, different, better, target, knowing, services, product, community, tho usands, potential |
usnewspapers.com - rank der domain 805822 (327425 in US)
|
| Business/Marketing_and_Advertising/Advertising/Print |
| zum Seitenanfang ↑ |
| Pro Baseball Newspaper Articles Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.probaseballarchive.com/ |
| Free archive of more than 50,000 historic newspaper articles concerning professional baseball. |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : probaseballarchive.com) |
| Sports/Baseball/Major_League/News_and_Media |
| zum Seitenanfang ↑ |
| Inside Time |
| Inside Time Latest Issue - the National Newspaper for Prisoners |
| http://www.insidetime.org |
| A national newspaper for prisoners. Includes news, articles and letters. |
| The online version of Inside Time, issue July 2010, a national monthly newspaper for prisoners |
| inside time, prisoner newspaper, prisoner magazine, inside time newspaper |
| mailbag, contact, publications, inside, latest, support, regimes, 2010headlines, grants, sheets, add resses, training, solicitors, insidetime, glossary, advertise, newspaper, prisoners, national, insid e, headlines, information, subscribe, issues |
insidetime.org - rank der domain 471804 (14827 in GB)
|
| Regional/Europe/United_Kingdom/Society_and_Culture/Issues/Crime_and_Justice |
| zum Seitenanfang ↑ |
| Abraham Lincoln Newspaper Articles Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.abrahamlincolnarchive.com |
| A free archive of over 25,000 newspaper pages about Abraham Lincoln |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : abrahamlincolnarchive.com) |
| Society/History/By_Region/North_America/United_States/Presidents/Lincoln,_Abraham |
| zum Seitenanfang ↑ |
| Newspaper "Diabetas" |
|
| http://www.dia.lt/newspaper/ |
| The official newspaper of Lithuanian Diabetes Association. Keeps readers in touch with progress in m edical care and research, association activities, latest legislation affecting people with diabetes, practical hints on day to day problems. |
| |
| |
| |
| (SLD : dia.lt) |
| Regional/Europe/Lithuania/Health/Newsletters |
| zum Seitenanfang ↑ |
| Town-Crier Online |
| The Town-Crier Newspaper |
| http://www.thecrier.com/ |
| News, sports, opinions, schools, and community information. |
| Newspaper Serving Wellington, Royal Palm Beach, Loxahatchee & The Acreage |
| |
| window, widget, newspaper |
| (SLD : thecrier.com) |
| Regional/North_America/United_States/Florida/Counties/Palm_Beach/News_and_Media |
| zum Seitenanfang ↑ |
| College Basketball Newspaper Articles Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.collegebasketballarchive.com |
| A large collection of historical newspaper articles about college basketball. |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : collegebasketballarchive.com) |
| Sports/Basketball/News_and_Media |
| zum Seitenanfang ↑ |
| Washington-Baltimore Newspaper Guild |
| Washington-Baltimore Newspaper Guild |
| http://www.wbng.org/ |
| Represents local newspaper workers, affiliated with the Communications Workers of America. |
| Web site of the Washington-Baltimore Newspaper Guild, Local 32035 of The Newspaper Guild-Communicati on Workers of America. WBNG is the union that represents some 3,000 workers in the news and informat ion industry and on the staffs of labor organizations in metropolitan Washington, D.C., and Baltimor e. |
| |
| pausecontent, august, agreement, raises, correspondents, 22jobs, pausing, scroller, contract, justic e, unitwins, tentative, serviceguild, arrays, message, example, washington, baltimore, newspaper, sc rollers, 7catholic, november |
| (SLD : wbng.org) |
| Regional/North_America/United_States/Washington,_DC/Society_and_Culture/Labor |
| zum Seitenanfang ↑ |
| Titanic Newspaper Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.titanicarchive.com |
| A collection of over 15,000 articles. |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : titanicarchive.com) |
| Society/History/By_Topic/Maritime/Ships/Ocean_Liners/Titanic |
| zum Seitenanfang ↑ |
| Eagle Independent |
| Eagle Idaho Newspaper is Redirecting to our New Site! |
| http://eagleindependent.com |
| View pdfs of monthly publication distributed free to residents of Eagle. Advertising information, ar chived issues, and contact details. |
| Eagle Idaho Newspaper. Get local news and information. |
| Eagle Idaho Newspaper, Eagle Idaho, Eagle Newspaper, Ada County Newspaper, Idaho Online Newspaper |
| independent, newspaper, information, direct, residents, mailed, people, another, newspapers, newspap er, events, advertising, medals, gymnasts, fifteen, gymnasts, travel, enough, articles, fortunate, g ymnastics, assistance, newsletter, properly, download, current, installed, reader, acrobat, latest, stuffed, proudly, process, taxidermy, display, someone, covington, kentucky, skilled, talented, arti cle, appears, bringing, redirecting, editorial, largest, merged, western, county, publication, distr ibution |
| (SLD : eagleindependent.com) |
| News/Newspapers/Regional/United_States/Idaho |
| zum Seitenanfang ↑ |
| Amandala Online |
| Belize News - Belize Leading Newspaper | Breaking News - Amandala Online |
| http://www.amandala.com.bz/ |
| Largest circulation independent newspaper in Belize. Now published bi-weekly Tuesdays and weekend (m ain) edition. |
| Belize News! AMANDALA has been the nation's most read newspaper for Belize news since Belize's Indep endence in 1981. The AMANDALA is the nation's leading newspaper - a 33 year old voice of the people of Belize |
| Belize news, Belize newspaper online, daily newspaper, Amandala, newspaper archives, auto classified s, press releases |
| belize, publisher, online, amandala, newspaper, leading, breaking, unveils, visited, silver, cemeter y, attacking, charged, policeman, diving, headline, crispin, yolanda, western, highway, senator, let ter, classified, letters, editorial, article, search, features, sports, general, politics, internati onal, education, updated, amandala, bookmarktitle, document, latest, bookmarkurl |
| (SLD : com.bz) |
| Regional/Central_America/Belize/News_and_Media |
| zum Seitenanfang ↑ |
| China Newspaper |
| China Newspaper |
| http://www.china-newspaper.de |
| Blog mit Nachrichten aus Politik, Wirtschaft und Kultur. |
| |
| |
| widgetmanager, widgetinfo, registerwidget, sidebar, document, displaymodefull, getelementbyid, jstim ing, newspaper, sienat, chinas, eingestellt, function, deutschland, theater, newspaper, blogspot, ch rome, uiguren, blogger, htmlview, 42http, chinesische, 74link, februar, window, offsetparent, 714763 5143150786177, external, gtbexternal, 42application, donnerstag, natschke, siegmund, brechts, taiwan , politische, inhalte, brecht, wichtigsten, seiner, default, impfen, neujahrsfest, wirtschaftliche, 42china, peking, november, olympia, zerfall, weidenfeld |
| (SLD : china-newspaper.de) |
| World/Deutsch/Regional/Asien/China/Nachrichten_und_Medien |
| zum Seitenanfang ↑ |
| Winter Games Newspaper Articles Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.wintergamesarchive.com |
| A collection of reportedly over 50,000 historical newspaper articles about the Winter Olympics. Free to access. |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : wintergamesarchive.com) |
| Sports/Events/Olympics/Winter_Games |
| zum Seitenanfang ↑ |
| Asian Pages Newspaper |
| Asian Pages Newspaper |
| http://www.asianpages.com |
| A leading Midwest Asian resource, covering current events, news, sports, entertainment, and politics . |
| |
| |
| browser, support, frames, newspaper |
| (SLD : asianpages.com) |
| Regional/North_America/United_States/Regions/Midwest/Society_and_Culture |
| zum Seitenanfang ↑ |
| Русский маркет |
| Russian Market Newspaper |
| http://www.russianmarket.net/ |
| Рекламный еженедельник на русском и английском языках. |
| |
| |
| russian, market, available, newspaper, internet, edition, newspapers, continue, english, button, ple ase, popular, newspaper, community, biggest, welcome, published, updated |
| (SLD : russianmarket.net) |
| World/Russian/Страны_и_регионы/Северная_Америка/Соединенные_Штаты_Америки/Пенсильвания |
| zum Seitenanfang ↑ |
| Newspaper Obituaries On The Web |
| Newspaper Obituaries On The Net |
| http://www.newspaperobituaries.net |
| A directory of obituary databases and archives on the web |
| A directory of over 6 million free newspaper obituaries on the internet |
| obituary,obituaries,databases,newspaper,internet |
| newspaper, obituaries, heritage, published, obituary, notice, american, deceased, internet, sometime s, biography, obituary, center, style2, style1, style3, archives, databases, directory, ff0000 |
newspaperobituaries.net - rank der domain 510027 (204315 in US)
|
| Society/Genealogy/Obituaries |
| zum Seitenanfang ↑ |
| The Wymsey Chronicle |
| The Wymsey Chronicle - the local newspaper worth dying for. |
| http://www.wymsey.co.uk/wymnews2.htm |
| A weekly newspaper that deals with the essence of English rural life. |
| The Wymsey Chronicle - the local newspaper worth dying for |
| wymsey, newspaper, news, paper, parish, whimsey, parody, spoof, irony, satire, council, village, par ish council, radio, community, amatuer, ham, ofcom, plt, power line adaptor, vision, ukqrm, rsgb, sh ort, wave, shortwave |
| newspaper, wymsey, chronicle |
| (SLD : wymsey.co.uk) |
| Recreation/Humor/Parodies/News_and_Media |
| zum Seitenanfang ↑ |
| Pacific Northwest Newspaper Guild |
| The Newspaper Guild |
| http://www.newsguild.org/ |
| Union that represents newspaper workers from the Seattle Times, Post-Intelligencer and many other pu blications in the Northwest. |
| Home page for The Newspaper Guild, Communications Workers of America, The Newspaper Guild, TNG, CWA, The Guild Reporter |
| Newspaper union, union contracts, The Newspaper Guild, The Guild Reporter, TNG, CWA |
| stories, rights, current, newspaper, harassment, communications, sexual, program, workers, america, contracts, journalismreview, rights, organize, mission, calendar, ntilde, contact, border, poynter, archives, romenesko, useful, wikipedia, sitemap, american, columbia, chainlinks, stories, workersof, guildcommunications, washington, street, style3, noborder, style1, center, style2, information, mes sage, president, history, organizing, eguity, information, recent, organize, boxborder, statement, a rchives, outline |
newsguild.org - rank der domain 892601 (382210 in US)
|
| News/Newspapers/Regional/United_States/Washington |
| zum Seitenanfang ↑ |
| Historic Newspaper Archives |
| |
| http://www.historicnewspaper.com/ |
| Sells newspapers from the USA and around the world dating back to 1880. |
| From original newspaper gifts to premium newspaper gift boxes. We have a wide range of stunning news paper themed gifts for all occasions. |
| |
| reprint, newspaper, newspaper, ywatracker, replace, personalized, special, document, simply, newspap ers, pagetracker, original, function, contact, simplypersonalized, signature, headlines, historic, s hirts, search, delivery, greetings, framed, commemorative, facebox, gajshost, perfect, banner, categ ory, gettracker, loading, initdata, helpdesk, checkout, script, 10296544, occasion, person, helpful, birthday, information, thwarte, submit, securetrading, securecode, transactions, verified, masterca rd, setaction, 10001143457149, globals |
| (SLD : historicnewspaper.com) |
| Shopping/Antiques_and_Collectibles/Ephemera/Periodicals |
| zum Seitenanfang ↑ |
| Journalism |
| Newspaper Publishing |
| http://www.suite101.com/welcome.cfm/journalism |
| Archive of articles by Daryl Lease. |
| Writers, students and publishers will find information on newspaper publishing and journalism, as we ll editing Newspapers and Newspaper Markets |
| newspaper publishing, newspaper markets,mainstream journalism,editing news stories,breaking stories, associated press,newspaper culture,markets,sales, audience, |
| publishing, document, newspaper, writing, getelementbyid, journalism, seidenberg, reporters, suite10 1, kathlin, leaderboard, sickel, articles, innerhtml, online, newspaper, writingandpublishing, stori es, online, newspapers, protocol, suite101, journalism, loader, freelance, newspapers, writers, repo rting, publishing, bolster, washington, government, industry, lawrence, article, 728x90, admanager, beacon, business, adsense, editing, contributors, lindzon, american, subscribe, hidden, editor, futu re, history, future, matters |
suite101.com - rank der domain 2790 (1082 in US)
|
| Arts/Writers_Resources/Non-Fiction/Journalism |
| zum Seitenanfang ↑ |
| Nigerian Newspaper |
| Nigerian Newspaper: Get Nigeria news from Nigerian newspapers |
| http://www.nigerian-newspaper.com/ |
| Reviews and lists Nigerian newspapers and magazines. Also offers links to news articles. |
| Nigerian newspaper reviews and lists Nigerian daily newspapers. Also offers links to news articles a bout Nigeria. |
| nigerian newspaper,nigerian newspapers, nigeria, nigeria newspaper, nigerian daily newspapers, niger ian newspapers online, nigeria news papers, nigerian daily newspaper, nigerian newspaper online |
| nigerian, nigeria, newspaper, newspapers, information, opinion, culturally, english, official, langu age, diverse, growing, community, rapidly, countries, invite, quandary, enthralled, headlines, lover s, absence, president, series, produced, nigerian, political, articles, featured, mohammed, landscap e, political, galadima, friends, entirely, intend, reviews, issues, focuses, providing, movies, maga zines, prominent, ultimate, dialect, peculiar, yoruba, languages, groups, ethnic, direction, pointin g |
nigerian-newspaper.com - rank der domain 516575 (157 in NG)
|
| News/Newspapers/Directories |
| zum Seitenanfang ↑ |
| Providence Newspaper Guild |
| Providence Newspaper Guild - Home |
| http://www.riguild.org/ |
| This is the web site for the Providence Newspaper Guild, TNG CWA Local 31041, the union which repres ents newspaper workers of Southern New England |
| This is the Web site for the
Providence Newspaper Guild, TNG CWA Local 31041, the union which
repr esents newspaper workers of Southern New England |
| Guild, union, labor, newspaper employees,
Providence Journal, Rhode Island, Worcester, Worcester Te legram Gazette,
TNG, CWA, 31041 |
| months, providence, newspaper, contract, members, pension, national, contract, contract, schick, jou rnal, administrator, annual, protections, friday, office, benefits, follies, pawtucket, woonsocket, economic, pension, protects, workers, payments, proposal, additional, members, arbitration, establis hes, contracr, raises, provides, expands, worcester, newspaper, business, approve, particularly, gua rantees, around, summary, million, during, ability, successor, copyright, available, advise, issues, riguild |
| (SLD : riguild.org) |
| Regional/North_America/United_States/Rhode_Island/Localities/P/Providence/Business_and_Economy/Employment |
| zum Seitenanfang ↑ |
| The Aurora Newspaper |
| The Aurora Newspaper - 14 Wing Greenwood |
| http://www.auroranewspaper.com/ |
| The weekly newspaper of 14 Wing (Canadian Air Force) of Greenwood, Nova Scotia, presents articles of interest to the wing, community and those interested in Air Force matters. Lists issues and article s, advertising and military news links. |
| |
| |
| promotions, welcome, health, winter, carnival, aurora, newspaper, greenwood, fitness, centre |
| (SLD : auroranewspaper.com) |
| News/Newspapers/Regional/Canada/Nova_Scotia |
| zum Seitenanfang ↑ |
| Fashion Newspaper |
| Fashion Newspaper |
| http://www.fashionnewspaper.com |
| Fashion news articles and blogs regarding fashion relevant issues from the Apparel Search Company. |
| Fashion news and fashion articles. The Fashion Newspaper site provides news and information regardi ng fashion, textiles, clothing and apparel |
| fashion, fashion news, fashion newspaper, fashion newspapers, clothing, apparel, clothing news, appa rel news, textile news, modeling, garments, garment, fabric, designers, style |
| fashion, newspaper, disclaimer, industry, notice, syndicate, gadgets, widget, contact |
fashionnewspaper.com - rank der domain 722287 (292531 in US)
|
| Business/Consumer_Goods_and_Services/Clothing/News_and_Media/Publications |
| zum Seitenanfang ↑ |
| Asianlite |
| Asian news in the UK |
| http://www.asianlite.co.uk/ |
| Online newspaper backed up with a hard copy monthly newspaper targeted at British Asian professional s. News, sport, business and cultural sections. |
| Asian local news and newspapers comments |
| Asian news in the UK, Asian newspapers in the UK, Asian newspaper in the UK, UK's leading Asian news paper, Leading Asian newspaper in the UK, Leading Asian newspaper in Britain, Quality journal for Br it Asians, Newspaper for professional British Asians, Newspaper for Indian immigrants in the UK, Asi an local news and newspapers comments |
| indian, newspaper, newspapers, accident, origin, britain, malaysian, corner, reviews, newspaper, asi ans, leading, professional, british, praises, bollywood, fashion, birthday, couture, bridal, changes , katrina, sudhir, government, mishra, battle, offers, comments, varsities, canadian, indians, fleec ing, undergrads, impress, expensive, kargil, immigrants, devotees, throng, continues, tennis, journa l, ethnic, champions, france, copyright, reserved, policy, privacy, rights, quality |
| (SLD : asianlite.co.uk) |
| Regional/Europe/United_Kingdom/England/Manchester/News_and_Media |
| zum Seitenanfang ↑ |
| Journalism |
| Newspaper Publishing |
| http://www.suite101.com/welcome.cfm/journalism |
| Archive of articles by Daryl Lease. |
| Writers, students and publishers will find information on newspaper publishing and journalism, as we ll editing Newspapers and Newspaper Markets |
| newspaper publishing, newspaper markets,mainstream journalism,editing news stories,breaking stories, associated press,newspaper culture,markets,sales, audience, |
| publishing, document, newspaper, writing, journalism, getelementbyid, seidenberg, reporters, suite10 1, innerhtml, freelance, leaderboard, kathlin, sickel, articles, online, stories, writingandpublishi ng, newspaper, loader, newspapers, newspapers, online, suite101, journalism, writers, american, cont ributors, native, adsense, editing, lawrence, hidden, bolster, industry, publishing, matters, report ing, future, history, future, government, business, college, editor, articles, article, washington, subscribe, lindzon, writers |
suite101.com - rank der domain 2790 (1082 in US)
|
| News/Media/Journalism/Resources |
| zum Seitenanfang ↑ |
| The Baron |
| The Baron |
| http://www.barononline.ca/ |
| Student newspaper at the University of New Brunswick at Saint John. Six issues per semester. |
| The Baron is UNB Saint John's student-run newspaper, all articles are now published online as well. |
| unbsj, unbsj school newspaper, school newspaper, unb newspaper, unbsj newspaper, the baron, baron |
| graham, university, premier, opinions, sports, features, student, athletes, concerns, rights, alliso naramark, athletes, nation, 16thcontroversies, february, reserved, olympics, purpose, commons, godde ss, powered, wordpress, content, wortman, maintained, website, updated, lockergreengrass, design, th eatrethe, buildingshoe, string, changing, ebooks, zonehow, battle, campus, covering, semester, issue s, around, provide, population, community, country, publishes, editoral, wednesday, community, calen dar, newspaper |
| (SLD : barononline.ca) |
| News/Colleges_and_Universities/Newspapers/Canada/New_Brunswick |
| zum Seitenanfang ↑ |
| Providence Newspaper Guild |
| Providence Newspaper Guild - Home |
| http://www.riguild.org/ |
| The union which represents newspaper workers of Southern New England. |
| This is the Web site for the
Providence Newspaper Guild, TNG CWA Local 31041, the union which
repr esents newspaper workers of Southern New England |
| Guild, union, labor, newspaper employees,
Providence Journal, Rhode Island, Worcester, Worcester Te legram Gazette,
TNG, CWA, 31041 |
| months, providence, newspaper, contract, members, pension, national, contract, contract, schick, jou rnal, administrator, annual, protections, friday, office, benefits, follies, pawtucket, woonsocket, economic, pension, protects, workers, payments, proposal, additional, members, arbitration, establis hes, contracr, raises, provides, expands, worcester, newspaper, business, approve, particularly, gua rantees, around, summary, million, during, ability, successor, copyright, available, advise, issues, riguild |
| (SLD : riguild.org) |
| Regional/North_America/United_States/Rhode_Island/Localities/P/Providence/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| Milan Family YMCA |
| The McKenzie Banner Online - Your GOOD NEWSpaper |
| http://www.mckenziebanner.com/2005/2005features/feature_YMCA_Mar30_05.htm |
| Newspaper article describes the facility and programs. |
| |
| |
| mckenzie, banner, subscribe, edition, online, newspaper, ff0000 |
| (SLD : mckenziebanner.com) |
| Regional/North_America/United_States/Tennessee/Localities/M/Milan/Society_and_Culture |
| zum Seitenanfang ↑ |
| Fourth Estate |
| Fourth Estate Newspaper |
| http://www.fourthestatenewspaper.com |
| Weekly student newspaper of the University of Wisconsin at Green Bay. |
| Fourth Estate Newspaper, a college media publication. |
| Fourth Estate Newspaper, newspaper, college media, student media |
| secref, paperid, document, dispatcher, chvalue, setattribute, sectionvalue, pagevalueorg, pagevalue, storyname, indexof, college, filterdomain, showclientbanner, clientbannersavailable, fourth, estate , radder, newspaper, sports, shownetworkbanner, students, textbooks, archives, getcookie, phoenix, p ublisher, warren, orgpath, fourthestatenewspaper, filtervar, sectioncategory, whitney, campus, weekd ay, soccer, powered, bookstore, advertisement, entertainment, center, future, policy, changes, satur day, bombing, comment, failed, getting, possible, family |
| (SLD : fourthestatenewspaper.com) |
| Reference/Education/Colleges_and_Universities/North_America/United_States/Wisconsin/University_of_Wisconsin/Green_Bay |
| zum Seitenanfang ↑ |
| The Star-News Online |
| Outdated Link |
| http://www.webdms.com/~starnews/ |
| Community newspaper of McCall and surrounding areas. Includes visitor information. |
| |
| Idaho,McCall,McCall Idaho,newspaper,Idaho newspaper |
| |
| (SLD : webdms.com) |
| News/Newspapers/Regional/United_States/Idaho |
| zum Seitenanfang ↑ |
| Missaukee Sentinel |
| Missaukee Sentinel Newspaper |
| http://www.missaukeesentinel.com/ |
| A weekly newspaper distributed every Friday, features local news, sports, weather, classifieds, and feature stories. |
| |
| |
| newspaper, missaukee, sentinel |
| (SLD : missaukeesentinel.com) |
| Regional/North_America/United_States/Michigan/Counties/Missaukee/News_and_Media |
| zum Seitenanfang ↑ |
| Mississippi Press Association |
| Mississippi Press Association | Mississippi Press Services, Inc. |
| http://www.mspress.org/ |
| Represents Mississippi newspapers. Press releases, directory of member papers, and job leads for jou rnalists. |
| Mississippi Press Association and Mississippi Press Services offer one stop one check newspaper adve rtising across Mississippi or across the country. |
| mississippi press association, mississippi press services, newspaper, newspaper advertising, press, mississippi classified advertising, mississippiclassifiedadvertisingnetwork, newspaper classified ad vertising network, newspaper display advertising, Retail Advertising Training, Newspaper Advertising Sales Training, Basic Training for New Advertising Representatives, Weekly and Daily Newspapers, Ro okieNewspaperAdvertisingSalesTraining, Magazines, Shoppers, Pennysavers, Daily, Weekly, Dailies, Wee klies, Publications, Metro Newspapers, Public Notice Newspaper Advertising, Newspaper Ad Sales Train ing, newspapers, journalism |
| mississippi, association, services |
| (SLD : mspress.org) |
| Regional/North_America/United_States/Mississippi/Society_and_Culture/Organizations |
| zum Seitenanfang ↑ |
| Homes Newspaper |
| Homes Newspaper Realtor Listing Tool |
| http://www.homesnewspaper.com/ |
| Publishing of personalized newspapers for real estate professionals in Canada and the United States. Includes rate card, printing schedule, and terms of agreement. |
| Homes Newspaper is a Realtors Listing tool designed
to help Real Estate Agents sell homes with suc cess. |
| Homes Newspaper, newspaper for realtors listing tool, realtors, real estate, selling homes, Real es tate newsletter, real estate newspaper, real estate listing tool, listing tool, homes magazine, home s newspaper, real estate insider information, the real estate insider newspaper, real estate insider newspaper, custom real estate newspaper, custom newsletter, custom real estate tool, custom real es tate printing, personal newspaper, personal newsletter, real estate marketing tool, professional lis ting tool, proven listing tool, full color custom newspaper, color custom newspaper, full color cust om newsletter, color custom newsletter, real estate magazine, custom house publishing, custom design real estate newspaper, custom designed real estate newspaper, custom designed listing tool,your new spaper, your home newspaper, exclusive newspaper, homes newspaper, newspaper for realtors, personal newspaper for realtors, free newspaper for realtors, personalized newspapers for realtors, realtor l isting tool, realtor mar |
| estate, newspaper, custom, listing, agents, realtors, newspapers, newspaper, newsletter, personal, m arketing, designed, realtor, newsletters, selling, provided, personalized, buying, construction, pub lication, homesnewspaper, income, increase, houses, professional, printed, condos, proven, additiona l, estate, enormously, testimonial, quality, endorsement, benefit, current, solutions, moving, magaz ine, garden, inside, information, seller, insider, relocation, relocating, listings, realestate, gre ater, exclusive, condosource |
| (SLD : homesnewspaper.com) |
| Business/Real_Estate/Marketing_and_Advertising |
| zum Seitenanfang ↑ |
| Target America Newspaper Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.targetamericaarchive.com/Home.aspx |
| Searchable archive of articles detailing attacks on U.S. soil. |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : targetamericaarchive.com) |
| Society/History/By_Time_Period/Twentieth_Century/Wars_and_Conflicts/World_War_II/By_Country/United_States |
| zum Seitenanfang ↑ |
| Warrandyte Diary |
| Warrandyte Diary: community newspaper |
| http://home.vicnet.net.au/~warrandy/ |
| Monthly community newspaper of Warrandyte and district, Victoria, Australia. |
| The Warrandyte Diary is the monthly community newspaper of Warrandyte and district, Victoria, Austra lia |
| Warrandyte Diary, community, news, newspaper, sports, features, columns, Wonga Park, Warranwood, Kan garoo Ground, Australia, Yarra, river |
| warrandyte, traffic, community, reduced, congestion, course, newspaper, holding |
vicnet.net.au - rank der domain 133587 (827 in AU)
|
| Regional/Oceania/Australia/Victoria/Regions/Greater_Melbourne/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| New Voice Of New York |
| NEW VOICE OF NEW YORK NEWSPAPER |
| http://newvoiceofnewyork.tripod.com/ |
| Items from a weekly publication covering local, national and world news. Mirrors an interracial news stand publication for New York. Covers politics, community affairs, health, education, crime, sports and Broadway theater. |
| A FULL FEATURED WEEKLY NEWSPAPER PUBLICATION. DISTRIBUTED WORLD-WIDE
COVERING COMMUNITY AND WORLD NE WS. CAPTURES THE TRUE
HEART, MIND, IMAGINATION AND SOUL OF NEW YORKERS WITH ITS IN-DEPTH COVERAGE AN D
COSMOPOLITAN FLAIR. |
| Newspaper, NEWSPAPER, New Yorkers, NEW YORK CITY, NEWSPAPER,NEW YORK,NY VOICE, THE NEW VOICE OF NEW YORK, THE NEW VOICE OF NEW YORK NEWSPAPER, THE NEW YORK VOICE, THE NEW VOICE,New Yorkers |
| |
tripod.com - rank der domain 857 (45 in JP)
|
| News/Newspapers/Regional/United_States/New_York |
| zum Seitenanfang ↑ |
| Seattle On The Hill |
| Seattle's First Online Daily Newspaper - SeattleCourant.com |
| http://www.seattleonthehill.com/ |
| Online only newspaper serving the Capitol Hill neighborhood, with original reporting and free classi fieds. |
| Seattle's only 21st century online daily newspaper. Seattle's First Online Daily Newspaper Seattle n ews you can use. |
| seattle newspaper, seattle, newspaper, seattle news media, news, capitol hill, caphill, beacon hill, queen anne, fremont, ballard, local, seattle city council |
| seattle, opinion, courant, journalismo, people, online, tweets, newspaper, making, themselves, twitt er, pagetracker, gajshost, homeless, document, politics, culture, education, newspaper, opinion, fin ancial, hemming, joblessness, mcbride, culture, economy, holler, bygone, trillions, dollars, shouldn , hawing, advertising, yelling, television, please, streets, veterans, recent, saying, newsprint, ty pewriters, begging, staying, bullets, dodging, months, handmade, recalls, report, washington |
| (SLD : seattleonthehill.com) |
| Regional/North_America/United_States/Washington/Localities/S/Seattle/News_and_Media/Online |
| zum Seitenanfang ↑ |
| Minnesota Newspaper Guild/Typographical Union CWA |
| Minnesota Newspaper Guild |
| http://www.shoptalknet.org/ |
| Representing over 1100 employees at the Saint Paul Pioneer Press, Star Tribune, Catholic Spirit, Uni on Advocate, the Duluth Labor World and Minneapolis Labor Review. |
| Home page for Minnesota Newspaper Guild, Shoptalknet, Communications Workers of America, The Newspap er Guild |
| Newspaper union, union contracts, The Newspaper Guild, TNG, CWA |
| border, minnesota, journalism, program, collapse, review, newspaper, university, pioneer, benefit, t raining, background, employees, school, initiated, contract, innovative, kathleen, hansen, through, skills, opportunity, participate, negotiated, participation, newspaper, members, success, advertisin g, departments, editorial, communication, wikipedia, pipress, style1, avista, singleton, useful, rep orter, stylebordercollapse, bfe5bc, color2, 0d5236, color1, stylenoborder, information, calendar, co ntracts, communications, romenesko, poynter |
| (SLD : shoptalknet.org) |
| Regional/North_America/United_States/Minnesota/Society_and_Culture/Labor |
| zum Seitenanfang ↑ |
| Crayon.net |
| CRAYON.net - Create Your Own Newspaper |
| http://www.crayon.net/ |
| CReAte Your Own Newspaper. Decide on the publications you want and let CRAYON pull together all of t he headlines for you in one, easy to click home page. |
| CRAYON - Create Your Own Newspaper. The web's first personalized news service, custom news, headline s |
| CRAYON, create newspaper, own newspaper, personalized news, custom news, personal headlines, breakin g news, current topics |
| thecookie, cookiename, samsung, instructions, return, create, indexof, length, crayon, password, new spaper, sources, variety, current, subscribers, current, across, unfiltered, getting, biggest, award s, suggest, feedback, copyright, rights, reserved, questions, frequently, protest, sprint, coming, s ubscriber, unescape, substring, claims, antenna, smartphone, android, offers, galaxy, forgot, addres s, multimedia, intercept, software, successful, newspapers, tackle, newspaper, function, forced |
crayon.net - rank der domain 126086 (48756 in US)
|
| News/Personalized_News |
| zum Seitenanfang ↑ |
| Tennessee Newspaper Project |
| Tennessee Newspaper Project - Home Page |
| http://www.lib.utk.edu/spcoll/newspaper/tnphome.htm |
| Part of a national effort to locate, catalog, preserve on microfilm, and make accessible, newspapers published in the US from the earliest colonial days to the present. Site provides information about American newspapers held in the state's libraries. |
| Provides information about the Tennessee Newspaper Project and the United States Newspaper Program. Includes information about American newspapers held in Tennessee institutions. |
| Tennessee Newspaper Project, TNP, newspapers in Tennessee, Tennessee newspaper publishing history, n ewspaper preservation, access to newspapers, newspapers on microfilm, United States Newspaper Progr am, USNP |
| tennessee, newspaper, university, search, project, information, holdings, library, database, middot, newspapers, newspaper, contact, libraries, united, interlibrary, holdings, project, knoxville, acro ss, survey, libraries, system, states, provided, american, department, recent, comprehensive, access ing, institution, listed, borrowed, country, access, papers, contact, through, numbers, hodges, volu nteer, boulevard, telephone, copyright, addresses, institutions, includes, present, future, projects , related |
utk.edu - rank der domain 15058 (5603 in US)
|
| News/Newspapers/Regional/United_States/Tennessee |
| zum Seitenanfang ↑ |
| Keizer Times Newspaper |
| Keizertimes Newspaper |
| http://www.keizertimes.com/ |
| Online site for Keizer's only newspaper. |
| Community news for Keizer, Oregon |
| breaking news, keizer, marion county, oregon, community, iris festival, editorial, stories, keizerti mes |
| newspaper, keizertimes |
| (SLD : keizertimes.com) |
| Regional/North_America/United_States/Oregon/Localities/K/Keizer |
| zum Seitenanfang ↑ |
| Holocaust Newspaper Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.holocaustarchive.com |
| More than 50,000 fully searchable pages, including a timeline, history, The Store, and resource link s. |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : holocaustarchive.com) |
| Society/History/By_Time_Period/Twentieth_Century/Holocaust |
| zum Seitenanfang ↑ |
| Athlone Observer Newspaper Online |
| Welcome to Athlone Observer Newspaper On Line |
| http://homepage.eircom.net/~athloneobserver |
| Circulates in counties Westmeath, Roscommon, Galway, Longford and Offaly. |
| |
| |
| frames, observer, newspaper, welcome, athlone, issues, stories, viewed, browser, enabled |
eircom.net - rank der domain 13845 (19 in IE)
|
| Regional/Europe/Ireland/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| The Rocksprings Record |
| The Rocksprings ReCord, Newspaper for Rocksprings, Texas with Rocksprings, Texas real estate, antiques, news, and entertainment, Rocksprings Texas newspaper |
| http://www.rockspringsrecord.com/ |
| Features local news and town calendar. |
| The Rocksprings ReCord, Newspaper for Rocksprings, Texas with Rocksprings, Texas real estate, anti ques, news, and entertainment, Rocksprings Texas newspaper |
| The Rocksprings ReCord, Newspaper for Rocksprings, Texas with Rocksprings, Texas real estate, anti ques, news, and entertainment, Rocksprings Texas newspaper |
| rocksprings, resignation, council, gonzales, letter, pauline, declaring, written, presented, announc ed, allegiance, public, pledge, management, brought, nguyen, sacred, country, beautiful, father, coo rdinator, emergency, declared, inside, welcome, church, catholic, stories, members, addresses, ashle y, wandell, payment, antiques, estate, record, newspaper, entertainment, newspaper, edition, interne t, wednesday, council, regular, attorney, keaton, goller, lawanda, present, blackburn, latiolais |
| (SLD : rockspringsrecord.com) |
| News/Newspapers/Regional/United_States/Texas |
| zum Seitenanfang ↑ |
| The Pearl Harbor Newspaper Archive |
| Explore Historical Newspapers Online | NewspaperARCHIVE.com |
| http://www.thepearlharborarchive.com |
| Articles detailing the destruction caused during the darkest two hours and 20 minutes in the history of the American Navy. |
| NewspaperARCHIVE.com is the world's largest online provider of historic newspaper articles. Newspape rARCHIVE.com is a great resource for historical research, family history and searching old newspaper s. |
| Newspaper, history, newspaper articles, newspaper archive, genealogy, historical newspaper, newspape r headlines, archive, family history, newspaper search |
| function, document, getelementbyid, results, countstepper, displaystr, search, elelnvalueclean, text status, currentsearchresults, theimages, addclass, removeclass, targetdate, displayformat, namesearc h, hidden, padding, calcage, ignore, newspaperarchive, theform, images, undefined, anonymous, tolowe rcase, result, return, countactive, elefnvalueclean, planid, contentarea, tquery, search, typeof, re place, errorthrown, background, teaser, articles, validate, checked, aspnetform, newspaper, repeat, newspapers, remember, explore, advanced, stories, contact |
| (SLD : thepearlharborarchive.com) |
| Society/History/By_Time_Period/Twentieth_Century/Wars_and_Conflicts/World_War_II/Theaters_of_Operations/Pacific/Pearl_Harbor |
| zum Seitenanfang ↑ |
| Thai Town USA |
| Thaitownusa.com : Thai Newspaper Online - Thai Newspaper in Los Angeles, CA, USA |
| http://www.thaitownusa.com |
| หนังสือพิมพ์ไทย ประจำเมือง Los Angeles |
| Welcome to thaitownusa.com online - Thai News, Thai Newspaper Thai Community in America |
| thai News, thai Newspaper, thai communities, thai in american, thai in usa, newspaper in LA |
| import, document, function, hollywood, massage, thaitownusa, window, searchnews1, getelementbyid, bu lletin, pasadena, looking, rewards, information, gajshost, pagetracker, restaurant, florida, orange, search, update, menubar, resizable, scrollbars, entertain, theurl, features, beauty, txtsearch, cor ner, winname, loopedslider, newspaper, version, toolbar, player, thaitownusa, location, requires, st atus, content, graminifolia, student, advising, arundina, service, tourist, charkool, newview, picpo st, travel |
thaitownusa.com - rank der domain 965902 (5129 in TH)
|
| World/Thai/ข่าวและสื่อ/หนังสือพิมพ์ |
| zum Seitenanfang ↑ |
| The Sentinel |
| Obsentinel.com |
| http://www.womacknewspapers.com/obsentinel/ |
| Weekly news, sports and community events from the Outer Banks. |
| Manteo newspaper,Nags Head newspaper,Kitty Hawk newspaper,Kill Devil Hills newspaper,Southern Shores newspaper,Outer Banks Newspaper,Outer Banks News,Nags Head, NC,Manteo, NC,Outer Banks Media |
| Outer Banks, Nags Head,Manteo, news, Media, nags headbeach, birthplace of aviation, first flight, gu lf stream, gulfstream lighthouse, lost colony, obx, ocean, wrights, wright brothers, wright bros. |
| capable, browser, displaying, frames, requires, viewing, obsentinel |
womacknewspapers.com - rank der domain 970184 (408602 in US)
|
| Regional/North_America/United_States/North_Carolina/Regions/Coastal/Outer_Banks/News_and_Media |
| zum Seitenanfang ↑ |
| Newspaper Marketing Agency |
| Newspaper Marketing Agency | Homepage |
| http://www.nmauk.co.uk/ |
| Provides case studies, events, research, facts and figures on national newspaper advertising for adv ertisers, creative and media agencies. |
| Newspaper Marketing Agency | Homepage |
| Newspaper Marketing Agency, providing case studies, events, research, facts, figures on national new spaper advertising for advertisers, creative and media agencies |
| document, pagetracker, keyword, searchform, search, creative, benchmarking, papers, gajshost, unveil , africa, service, beyond, football, behind, thinking, during, experts, forward, driving, exclusive, newspapers, latest, sports, ground, breaking, interviews, project, ambitions, journalists, inspired , javascript, script, initdata, trackpageview, 4041460, gettracker, analytics, strsectionid, homepag e, agency, newspaper, marketing, location, protocol, google, 3cscript, unescape, newspaper, maximum, impact |
nmauk.co.uk - rank der domain 483695 (15217 in GB)
|
| Regional/Europe/United_Kingdom/Business_and_Economy/Industries/Media |
| zum Seitenanfang ↑ |
| Newspaper Abstracts |
| Newspaper Abstracts : Main |
| http://newspaperabstracts.com/ |
| User contributed newspaper abstracts from newspapers in the published prior to 1923. Most contributi ons are from North America and Great Britain. |
| |
| |
| newspapers, ancestors, united, states, newspaper, abstracts, newspaper, research, microfilm, newspap ers, information, charge, interested, extracts, search, boston, provided, through, pagetracker, sear ch, available, community, submitted, newest, november, weekly, beloit, publication, abstracts, senti nel, ticonderoga, february, articles, welcome, linked, gajshost, document, members, notices, library , member, church, appreciation, hardships, endured, understanding, triumphs, musical, reading, build ing, visited |
newspaperabstracts.com - rank der domain 490517 (196292 in US)
|
| Society/Genealogy/Resources/Searchable_Databases |
| zum Seitenanfang ↑ |
| Waycross Journal-Herald |
| Waycross Journal-Herald - SE Georgia's Greatest Newspaper |
| http://www.wjhnews.com/ |
| Daily newspaper for South Georgia. Includes local news and classifieds. |
| Waycross Journal-Herald - SE Georgia's Greatest Newspaper |
| waycross journal herald, waycross, local newspaper, advertise in waycross, ware county, georgia, |
| mydate, getmonth, getdate, scripts, getyear, getday, greatest, newspaper, georgia, waycross, journal , herald, current, javascriptkit, javascript, script, credit |
| (SLD : wjhnews.com) |
| News/Newspapers/Regional/United_States/Georgia |
| zum Seitenanfang ↑ |
| First News |
| First News Children's Newspaper - Official Site |
| http://www.firstnews.co.uk |
| Award-winning national newspaper for children aged 7-14. Online edition includes book reviews, compe titions and information about the editorial team. |
| |
| |
| official, newspaper, children |
firstnews.co.uk - rank der domain 282601 (815 in UK)
|
| Regional/Europe/United_Kingdom/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| Outer Banks Sentinel |
| Obsentinel.com |
| http://www.womacknewspapers.com/obsentinel/ |
| Weekly news, sports and community events from the Outer Banks. |
| Manteo newspaper,Nags Head newspaper,Kitty Hawk newspaper,Kill Devil Hills newspaper,Southern Shores newspaper,Outer Banks Newspaper,Outer Banks News,Nags Head, NC,Manteo, NC,Outer Banks Media |
| Outer Banks, Nags Head,Manteo, news, Media, nags headbeach, birthplace of aviation, first flight, gu lf stream, gulfstream lighthouse, lost colony, obx, ocean, wrights, wright brothers, wright bros. |
| capable, browser, displaying, frames, requires, viewing, obsentinel |
womacknewspapers.com - rank der domain 970184 (408602 in US)
|
| News/Newspapers/Regional/United_States/North_Carolina |
| zum Seitenanfang ↑ |
| Stayner Sun |
| |
| http://www.staynersun.ca/ |
| Newspaper established 1877 serves Clearview Township and the communities of Stayner, New Lowell and Creemore. Published weekly on Wednesdays. |
| Get the latest Meaford, Stayner, Blue Mountains and Collingwood neighbourhood news, sports, events a nd opinions from your Meaford Express, Blue Mountains Courier-Herald and Collingwood Connection news papers. |
| Meaford newspaper | Meaford news | Stayner news | Stayner newspaper | Blue Mountains news | Blue Mou ntains newspaper | Collingwood news | Collingwood newspaper |
| |
| (SLD : staynersun.ca) |
| Regional/North_America/Canada/Ontario/Localities/S/Stayner |
| zum Seitenanfang ↑ |
| Word On the Street |
| News... From Our Shoes - Raleigh, North Carolina Homeless Newspaper |
| http://choices.freeservers.com/ |
| Newspaper for and about the homeless. Editorials, columns, poetry, essays and contact information. |
| |
| |
| border, background, 3366cc, family, carolina, homeless, raleigh, newspaper |
freeservers.com - rank der domain 3953 (1502 in US)
|
| Regional/North_America/United_States/North_Carolina/News_and_Media |
| zum Seitenanfang ↑ |
| Spinnaker |
| |
| http://www.unf.edu/groups/spinnaker/ |
| Official campus newspaper of the University of North Florida with weekly issues outlining students l ife, news and events. |
| Spinnaker: The Official Newspaper of the University of North Florida |
| Spinnaker, UNF, newspaper, University of North Florida, college newspaper |
| loading |
unf.edu - rank der domain 109351 (42096 in US)
|
| Reference/Education/Colleges_and_Universities/North_America/United_States/Florida/University_of_North_Florida |
| zum Seitenanfang ↑ |
| The Oregonian newspaper (Portland) |
| The Oregonian | Oregon Online Newspaper - OregonLive.com |
| http://www.oregonlive.com/oregonian/ |
| Local and national news from the famous newspaper in the Pacific Northwest. |
| Get the latest Oregonian news from Portland, Salem, Bend, Eugene, Medford, Corvallis and more. Get a rticles from columnists, business, entertainment, sports news at OregonLive.com |
| Oregonian, the Oregonian, Oregonian newspaper, Oregon newspapers, the Oregonian newspaper, Portland Oregonian, Oregon news, online newspaper, US newspaper, local newspaper |
| oregon, portland, oregonian, version, document, business, beavers, stores, oregonlive, plastic, sear ch, living, county, latest, opinion, sports, entertainment, washington, school, record, working, cov erage, stories, account, strawberry, attractions, concert, register, oregonlive, indexof, function, sitesponsor, normal, leaderboard, useragent, navigator, configuration, mozilla, infielder, lowrie, b ibens, austin, returns, majors, boston, closing, facility, festivities, dominant, upcoming, elevated |
oregonlive.com - rank der domain 4885 (1823 in US)
|
| News/Newspapers/Regional/United_States/Oregon |
| zum Seitenanfang ↑ |
| Cobb Online: Marietta Newspaper |
| COBB NEWSPAPER - MARIETTA NEWSPAPER | Cobb County news, Marietta homes, Cobb real estate |
| http://www.cobbonline.com/ |
| Daily internet newspaper for Marietta and Cobb County, Georgia. |
| Cobb County newspaper, Marietta newspaper, Marietta GA news, Cobb news, Cobb County homes, Marietta homes, houses for sale, real estate, help wanted |
| Cobb newspaper, Cobb County newspaper, Marietta newspaper, Marietta GA news, Cobb County real est ate, Cobb real estate, Marietta real estate, Cobb realtors, Cobb County realtors Marietta realtors , Cobb homes Marietta homes, Cobb MLS houses for sale, Cobb County houses for sale, Cobb houses for sale, Marietta new homes, Cobb new homes and Cobb County new homes, Cobb houses for sale, Marietta houses for sale, Cobb County newspaper, Marietta newspaper, new homes, houses for sale, realtors, K ennesaw, East Cobb, East Cobb County, West Cobb, West Cobb County, Kennesaw, North Atlanta, Cumberla nd |
| commission, google, chairman, headlines, marietta, newspaper, county, online, loafing, creative, sun day, refresh, voters, tuesday, updates, latest, bloomberg, reload, atlanta, events, movies, restaura nts, version, loading, marietta, estate, faster, locations, matters, alternet, abcnews, atlanta, sea rch, hinessight, drudge |
| (SLD : cobbonline.com) |
| Regional/North_America/United_States/Georgia/Localities/M/Marietta/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| Mount Forest Confederate |
|
| http://www.mountforest.com/ |
| A weekly newspaper published each Wednesdays by J.W. Eedy Publications Limited, the Confederate is a member of the Canadian Community Newspaper Association, the Ontario Community Newspaper Association and the Ontario Press Council. |
| |
| |
| |
| (SLD : mountforest.com) |
| Regional/North_America/Canada/Ontario/Localities/M/Mount_Forest/News_and_Media |
| zum Seitenanfang ↑ |
| Mount Forest Confederate |
|
| http://www.mountforest.com/ |
| A weekly newspaper published each Wednesdays by J.W. Eedy Publications Limited, the Confederate is a member of the Canadian Community Newspaper Association, the Ontario Community Newspaper Association and the Ontario Press Council. |
| |
| |
| |
| (SLD : mountforest.com) |
| News/Newspapers/Regional/Canada/Ontario |
| zum Seitenanfang ↑ |
| The IronBlade |
| The Iron Blade Online Newspaper |
| http://www.ferrum.edu/ironblade/ |
| Ferrum College's official newspaper. |
| |
| |
| october, newspaper, online |
ferrum.edu - rank der domain 380903 (4883 in )
|
| Regional/North_America/United_States/Virginia/Localities/F/Ferrum |
| zum Seitenanfang ↑ |
| The Scots Independent |
| The Scots Independent Newspaper Online - The Flag in the Wind |
| http://www.scotsindependent.org/ |
| Scotland's longest running political newspaper with news and information about Scottish affairs from a nationalist viewpoint. |
| The Flag in the Wind from the Scots Independent Newspaper - fighting for an independent Scotland sin ce 1926 |
| Scots, Scotland, Independence, Newspaper, Scottish |
| scotland, independent, newspaper, political, system, anomalies, government, british, goldie, changes , current, naturally, election, general, compiled, things, office, continue, incumbent, pretty, mini ster, decide, nationalism, monthly, subscriptions, archives, features, online, weekly, online, newsp aper, bringing, information, shopping, content, scottish, copyright, promoting, scotland, campaignin g, edited, november, printed |
| (SLD : scotsindependent.org) |
| Regional/Europe/United_Kingdom/Scotland/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| The Lathrop Rush |
| The Lathrop Rush newspaper- Lathrop, California |
| http://www.lathroprush.com |
| A non-profit monthly newspaper that is distributed freely to all residents. |
| The Lathrop Rush Newspaper is a non-profit monthly newspaper that is distributed freely to all resid ents living in Lathrop, California. Established in 1986 we are here to supply information from the a reas of French Camp, Weston Ranch and Lathrop, Ca. to our local residents. |
| Rush, Lathrop Rush, Newspaper, Lathrop Ca., Lathrop California, Monthly newspaper, The Lathrop Rush Newspaper |
| lathrop, scrollbar, ffffff, 000000, prucalifornia, weather, information, harlan, editor, california, position, newspaper, residents, supply, therushinlathrop, weston, superpages, cavacocontact, french , 1998lathrop, 1752795194, mikasasushilathrop, 2828www, 95330ph, 1818fax, realtracker, roadlathrop, com15138, publication, 102916972, weston, 7294fcavaco, comfcavaco, 8802mobile, french, campphone, fo recasts, advertisethe, margin, lpxcenterpageinner, relative, 3dlight, 777777, shadow, highlight, dar kshadow, homestead, import, elements, center, absolute |
| (SLD : lathroprush.com) |
| News/Newspapers/Regional/United_States/California |
| zum Seitenanfang ↑ |
| Socialist Action |
| Socialist Action |
| http://www.socialistaction.org |
| Articles from the newspaper of the same name, upcoming events, and literature for sale. Socialist Ac tion is a sympathizing section of the United Secretariat of the Fourth International. |
| |
| |
| action, socialist, newspaper, newspaper |
| (SLD : socialistaction.org) |
| Regional/North_America/United_States/Society_and_Culture/Politics/Parties/Socialists/Marxist/Trotskyist |
| zum Seitenanfang ↑ |
| The Citizens' Voice Newspaper |
| |
| http://www.citizensvoice.com/ |
| Wilkes-Barre's local newspaper on the web. |
| |
| |
| |
citizensvoice.com - rank der domain 125282 (48432 in US)
|
| Regional/North_America/United_States/Pennsylvania/Localities/W/Wilkes-Barre/News_and_Media/Newspapers |
| zum Seitenanfang ↑ |
| Street Roots |
| Street Roots, nonprofit newspaper and online community in Portland, Oregon |
| http://streetroots.org/ |
| Portland, Oregon street newspaper and online community. |
| Street Roots is a nonprofit, grassroots newspaper that assists people experiencing homelessness and poverty by creating flexible income opportunities. Through education, advocacy and personal expressi on, we are a catalyst for individual and social change. |
| street, paper, portland, oregon, newspaper, homeless, poor peoples guide, rose city resource |
| community, portland, oregon, online, street, nonprofit, newspaper |
| (SLD : streetroots.org) |
| Society/Issues/Poverty/Homelessness/Street_Newspapers |
| zum Seitenanfang ↑ |
| The Sentinel Newspaper |
|
| http://www.sentinelassam.com |
| Internet edition of the newspaper from Guwahati. |
| |
| |
| |
sentinelassam.com - rank der domain 460585 (183971 in US)
|
| Regional/Asia/India/Assam/News_and_Media |
| zum Seitenanfang ↑ |
|