| Urban Baby |
|
| http://urbanbaby.com/ |
| A network of resource guides, interactive communities and an online store for urban parents in the t op metropolitan cities of the world. |
| |
| |
| imgelem, general, topics, document, return, urbanbaby, itrkid, getelementbyid, parentelem, pagetrack er, anyone, parties, disney, advertise, things, because, whipped, policy, change, interactive, ctrkp refix, gajshost, parentid, function, itrkuri, netxp1, working, career, rbxcprefixed, children, destu ri, techrepublic, newuri, francisco, parents, granddaughter, results, previous, cooking, olivia, gra ndma, recipes, school, lunchbox, cookies, script, minors, obsessive, serving, guests, casserole |
urbanbaby.com - rank der domain 58751 (22517 in US)
|
| Home/Family/Babies |
| zum Seitenanfang ↑ |
| GameFAQs Reviews |
| Chron X Reviews for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/review/196915.html |
| A compilation of reviews by users. |
| For Chron X on the PC, GameFAQs has 4 reviews. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, iphone, container, gamesp ot, interactive, gamefaqs, nintendo, parentelem, platforms, beacon, content, college, review, saturn , function, genesis, password, metacritic, reviews, search, advance, dreamcast, arcade, gamecube, ad vertise, ctrkprefix, parentid, rbxcprefixed, desturi, itrkuri, newuri, netxp1, comtechrepublicthe, f mmaxprepsmetacritic, comshopper, digital, commoblogicmp3, commysimonncaasearch, phones, sports, cbsn ews, players, sitemap, comurbanbaby, comuwirewallstripzdnet |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Strategy/Turn-Based/Chron_X/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| netxp1 |
|
|
| netxp1 |
| zum Seitenanfang ↑ |
| GameSpot |
| E3 2001 Hands-OnSimsVille - PC Previews at GameSpot |
| http://www.gamespot.com/pc/strategy/simsville/preview_2762367.html |
| Includes a preview of the game as seen at E3, and screen shots. |
| This new game combines elements of The Sims with SimCity. |
| |
| imgelem, document, simsville, gamespot, function, buildings, return, stations, getelementbyid, scrip t, previews, structures, skills, images, itrkid, parentelem, andreas, onsimsville, simcity, business , interactive, connect, different, location, facebook, scroll, across, entertainment, rbxcprefixed, stories, netxp1, actually, cbsinteractive, sports, cbsnews, cbssports, shopping, public, appendchild , ctrkprefix, police, typical, beacon, friends, current, really, within, construct, information, cur rently, newuri |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Simulation/God_Games/Sim_Games/SimsVille/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs: Wizardry |
| Wizardry FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/564837.html |
| FAQ and walkthrough. |
| For Wizardry on the PC, GameFAQs has 1 FAQ (game guide/walkthrough). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, ninten do, gamespot, interactive, parentelem, gamefaqs, platforms, college, content, parentid, itrkuri, bea con, metacritic, newuri, genesis, advance, dreamcast, gamecube, search, password, arcade, ctrkprefix , netxp1, advertise, function, rbxcprefixed, desturi, saturn, maxpreps, sports, overstock, internati onal, cbssports, speakers, solutions, cbsnews, hosting, fmmaxprepsmetacritic, sitesselect, sitebnetc bs, sportscbs, radiocbs, moblogic |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/W/Wizardry_Series/Wizardry_I_-_Proving_Grounds_of_the_Mad_Overlord |
| zum Seitenanfang ↑ |
| netxp1 |
|
|
| netxp1 |
| zum Seitenanfang ↑ |
| CNET.com: Simply RSS |
| RSS Feeds | Home - CNET.com |
| http://www.cnet.com/4520-6022-5115113.html |
| Directory of feeds from CNET.com, ZDNet, download.com, TechRepublic, builder.com, GameSpot, and Webs hot. |
| |
| |
| imgelem, document, windows, networks, return, getelementbyid, sidedoor, itrkid, products, function, height, require, parentelem, reserves, display, popular, interactive, content, readers, reviews, inf ormation, notebooks, downloads, newuri, version, 5115113, graphic, getelement, address, localvars, s hopper, popular, directory, available, innerhtml, windowheight, uservars, ctrkprefix, netxp1, distri buting, pagevars, itrkuri, parentid, desturi, specification, rbxcprefixed, topics, phones, product, mobile, attribution |
cnet.com - rank der domain 99 (48 in US)
|
| Computers/Internet/On_the_Web/Syndication_and_Feeds/RSS/Directories |
| zum Seitenanfang ↑ |
| GameFAQs - Codes and Secrets - Slayer |
| Slayer Cheats, Codes, and Secrets for 3DO - GameFAQs |
| http://www.gamefaqs.com/console/3do/code/917943.html |
| Collection of known cheats. |
| For Slayer on the 3DO, GameFAQs has 1 cheat. |
| |
| imgelem, document, classname, getelementbyid, playstation, message, return, itrkid, iphone, containe r, gamefaqs, function, parentelem, metacritic, platforms, interactive, nintendo, gamespot, beacon, s ubmission, advertise, content, college, password, desturi, rbxcprefixed, arcade, gamecube, ctrkprefi x, netxp1, advance, search, dreamcast, newuri, cheats, parentid, genesis, itrkuri, saturn, radiocbs, comshopper, solutionsgamespotinternationallast, sportscbs, fmmaxprepsmetacritic, commysimonncaasear ch, comtechrepublicthe, commoblogicmp3, insidertv, comcbsnews, comurbanbaby, comchowcnetcnet |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/Rogue-like/Slayer |
| zum Seitenanfang ↑ |
| GameFAQs: Avernum 4 |
| Avernum 4 Cheats, Codes, and Secrets for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/code/932021.html |
| Contains cheats for Avernum 4. |
| For Avernum 4 on the PC, GameFAQs has 11 cheat codes and secrets. |
| |
| document, imgelem, classname, playstation, getelementbyid, message, return, gamespot, iphone, avernu m, itrkid, container, parentelem, gamefaqs, interactive, platforms, function, nintendo, content, cri mes, college, advertise, character, metacritic, making, desturi, newuri, genesis, itrkuri, rbxcprefi xed, ctrkprefix, saturn, netxp1, parentid, search, advance, gamecube, submission, cheats, password, beacon, arcade, dreamcast, working, hosting, speakers, clearance, sitesselect, bargains, sitebnetcbs , overstock |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/A/Avernum_Series |
| zum Seitenanfang ↑ |
| GameFAQs: Arc the Lad |
| Arc the Lad FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/572644.html |
| Walkthroughs and FAQs. |
| For Arc the Lad on the PlayStation, GameFAQs has 10 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, gamespot, itrk id, interactive, parentelem, gamefaqs, platforms, nintendo, walkthrough05, gamecube, beacon, hacking , password, college, metacritic, search, content, advance, netxp1, rbxcprefixed, desturi, genesis, s aturn, ctrkprefix, itrkuri, parentid, dreamcast, arcade, function, newuri, advertise, comchowcnetcne t, forums, comcbssports, commysimonncaasearch, comurbanbaby, insidertv, comuwirewallstripzdnet, comc bsnews, sports, comtechrepublicthe, fmmaxprepsmetacritic, solutionsgamespotinternationallast, commob logicmp3 |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad |
| zum Seitenanfang ↑ |
| GameFAQs: Torneko: The Last Hope |
| Torneko: The Last Hope Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/374986.html |
| Reader reviews. |
| For Torneko: The Last Hope on the PlayStation, GameFAQs has 8 reviews. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, torneko, container, itrki d, gamespot, gamefaqs, interactive, platforms, parentelem, nintendo, advertise, techrepublic, metacr itic, 10gamefaqs, college, content, review, password, beacon, saturn, function, reviews, ctrkprefix, netxp1, arcade, gamecube, advance, search, dreamcast, genesis, rbxcprefixed, desturi, newuri, itrku ri, parentid, around, sitebnetcbs, previews, sportscbs, sitesselect, rankingsvisit, solutionsgamespo tinternationallast, fmmaxprepsmetacritic, movies, gameplay |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/D/Dragon_Warrior_Series/Torneko_-_The_Last_Hope/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs |
| Dragon Warrior VII Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/197152.html |
| Reader reviews and a preview. |
| For Dragon Warrior VII on the PlayStation, GameFAQs has 42 reviews. |
| |
| imgelem, document, warrior, playstation, classname, return, getelementbyid, dragon, itrkid, containe r, gamespot, 10dragon, iphone, parentelem, school, platforms, gamefaqs, nintendo, interactive, revie w, previews, metacritic, advertise, beacon, content, college, 10gamefaqs, finally, gameplay, simply, amazing, newuri, parentid, rbxcprefixed, ctrkprefix, password, itrkuri, search, dreamcast, genesis, arcade, gamecube, advance, netxp1, desturi, saturn, reviews, function, gamer6, including, resources gamespotvisit |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/D/Dragon_Warrior_Series/Dragon_Quest_VII/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/awards1998/ |
| http://www.gamespot.com/features/awards1998/ |
| Picks for the best and worst of 1998. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, gamespot, document, itrkid, parentelem, released, getelementbyid, function, obsessi on, netxp1, gaming, genres, difficult, ctrkprefix, marked, desturi, parentid, itrkuri, newuri, strat egy, rbxcprefixed, diversity, recent, balanced, between, gracefully, memory, almost, simulations, pa ckaging, choosing, content, better, themselves, concerned, harder, special, awards, achievement, pro cess, excited, future, subsided, seemed, ignored, heralded, hybrids, action, playing, shooters |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/News_and_Reviews/Awards/1998 |
| zum Seitenanfang ↑ |
| GameSpot's Guide |
| GameSpot - /features/baldurs_gg/ |
| http://www.gamespot.com/features/baldurs_gg/ |
| Walkthrough. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, contains, document, quests, itrkid, character, parentelem, locations, baldur, chara cters, monsters, comprehensive, enemies, gamespot, through, getelementbyid, deadly, detailed, availa ble, player, numerous, desturi, rbxcprefixed, ctrkprefix, itrkuri, parentid, newuri, netxp1, functio n, respective, showcase, manage, attributes, unsure, encounters, abilities, interesting, creation, p retty, development, important, description, actually, tavern, eleventh, corner, review, sheepish, lo oking, hanging |
gamespot.com - rank der domain 630 (263 in US)
|
|
| zum Seitenanfang ↑ |
| GameFAQs |
| F.E.A.R. Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/920744.html |
| Release data and a message board. |
| For F.E.A.R. on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, software, getelementbyid, itrkid, iphone, contain er, gamespot, parentelem, interactive, platforms, capture, games10, nintendo, gamefaqs, credits, pre views, director, college, content, advertise, metacritic, person, shooter, action, review, submissio n, arcade, netxp1, gamecube, advance, itrkuri, parentid, dreamcast, desturi, genesis, newuri, ctrkpr efix, rbxcprefixed, beacon, saturn, password, release, function, search, rankingsvisit, rankings, ga meplay |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/F/F.E.A.R. |
| zum Seitenanfang ↑ |
| GameFAQs |
| Robots Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/924608.html |
| Information and a message board. |
| For Robots on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, gamesntr, container, ipho ne, additional, robots, parentelem, gamefaqs, metacritic, platforms, interactive, nintendo, gamespot , submission, design, credits, advertise, arbp03, content, college, beacon, adventure, action, netxp 1, arcade, dreamcast, ctrkprefix, desturi, advance, parentid, newuri, gamecube, saturn, genesis, fun ction, itrkuri, rbxcprefixed, search, password, players, something, gamerankings, movietome, sitemap , phones |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action-Adventure/R/Robots |
| zum Seitenanfang ↑ |
| GameFAQs |
| Hellfire FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/47583.html |
| A selection of walkthroughs. |
| For Hellfire on the PC, GameFAQs has 4 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, gamespot, container, ipho ne, hellfire, gamefaqs, nintendo, interactive, platforms, parentelem, itrkuri, college, content, bea con, advertise, metacritic, parentid, saturn, password, search, genesis, netxp1, function, arcade, d esturi, gamecube, advance, newuri, rbxcprefixed, dreamcast, ctrkprefix, comurbanbaby, insidertv, spe akers, comtechrepublicthe, forgot, commysimonncaasearch, comshopper, players, hosting, comuwirewalls tripzdnet, solutions, international, cbssports, commoblogicmp3 |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/D/Diablo_Series/Diablo/Hellfire |
| zum Seitenanfang ↑ |
| GameFAQs |
| Pac-Pix Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/920755.html |
| Data, FAQs, reviews, and a message board. |
| For Pac-Pix on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, pixnamcontr, interactive, parentelem, platforms, nintendo, gamefaqs, gamecube, metacritic, submi ssion, advance, advertise, search, function, college, content, password, miscellaneous, arcade, cred its, previews, desturi, beacon, newuri, genesis, itrkuri, parentid, netxp1, ctrkprefix, saturn, rbxc prefixed, dreamcast, hosting, clearance, overstock, speakers, phones, digital, cameras, laptops, ran kingsvisit, bargains |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/P/Pac-Man_Games/Pac-Pix |
| zum Seitenanfang ↑ |
| GameFAQs: Master of Magic |
| Master of Magic FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/564960.html |
| An FAQ. |
| For Master of Magic on the PC, GameFAQs has 1 FAQ (game guide/walkthrough). |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, iphone, container, gamesp ot, nintendo, interactive, parentelem, gamefaqs, platforms, newuri, itrkuri, college, beacon, conten t, parentid, metacritic, advertise, dreamcast, search, advance, gamecube, genesis, saturn, function, netxp1, ctrkprefix, rbxcprefixed, desturi, password, arcade, sports, cbsnews, cbssports, internatio nal, moblogic, mysimon, shopper, maxpreps, solutions, comuwirewallstripzdnet, commoblogicmp3, guides , sitesselect, sitebnetcbs, bargains |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Strategy/Turn-Based/Master_of_Magic |
| zum Seitenanfang ↑ |
| GameFAQs: Arc the Lad II |
| Arc the Lad II FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/572645.html |
| Provides numerous walkthroughs and faqs. |
| For Arc the Lad II on the PlayStation, GameFAQs has 19 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, ninten do, gamespot, interactive, gamefaqs, platforms, parentelem, metacritic, beacon, college, content, wa lkthrough06, advertise, saturn, function, ctrkprefix, netxp1, gamecube, advance, search, password, a rcade, genesis, dreamcast, rbxcprefixed, itrkuri, newuri, parentid, desturi, bargains, solutionsgame spotinternationallast, overstock, speakers, hosting, rankingsvisit, clearance, comcbsnews, radiocbs, comcbssports, comchowcnetcnet, sportscbs, sitesselect, sitebnetcbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad_II |
| zum Seitenanfang ↑ |
| TV.com: Christopher Khayman Lee |
| Christopher Khayman Lee on TV.com |
| http://www.tv.com/christopher-khayman-lee/person/18209/summary.html |
| Filmography and biographical information. |
| |
| Christopher Khayman Lee, , photos, videos, life, biography, career, credits |
| imgelem, document, return, itrkid, videos, getelementbyid, background, khayman, parentelem, christop her, ctrkprefix, rbxcprefixed, parentid, newuri, desturi, features, itrkuri, function, height, heade r, photos, people, position, netxp1, adinfo, fbhost, connect, quotes, awards, category, trivia, epis odes, winners, nominations, reviews, remove, favorites, dispatches, writers, search, credits, append child, domino, createelement, features, encodeuricomponent, overview, images, lights, sucked, admitt ed |
tv.com - rank der domain 1788 (716 in US)
|
| Arts/People/L/Lee,_Christopher_Khayman |
| zum Seitenanfang ↑ |
| Engine Settings FAQ |
| F-Zero X FAQs, Walkthroughs, and Guides for Nintendo 64 - GameFAQs |
| http://www.gamefaqs.com/console/n64/game/197414.html |
| Walkthrough and FAQs. |
| For F-Zero X on the Nintendo 64, GameFAQs has 10 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, classname, playstation, return, nintendo, getelementbyid, itrkid, container, ipho ne, interactive, platforms, gamespot, parentelem, gamefaqs, beacon, itrkuri, advertise, college, met acritic, content, saturn, password, function, netxp1, dreamcast, arcade, gamecube, advance, genesis, search, ctrkprefix, rbxcprefixed, desturi, parentid, newuri, bargains, comshopper, clearance, hosti ng, comtechrepublicthe, overstock, sitesselect, sitebnetcbs, commoblogicmp3, commysimonncaasearch, c omchowcnetcnet, solutionsgamespotinternationallast, comcbssports, comcbsnews, speakers |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Driving_and_Racing/Racing/F-Zero_Series/F-Zero_X |
| zum Seitenanfang ↑ |
| TV.com: Brooke Nevin |
| Brooke Nevin on TV.com |
| http://www.tv.com/brooke-nevin/person/68940/summary.html |
| Filmography and biographical information. |
| |
| Brooke Nevin, , photos, videos, life, biography, career, credits |
| imgelem, document, return, itrkid, videos, getelementbyid, brooke, background, parentelem, netxp1, c trkprefix, features, rbxcprefixed, newuri, adinfo, height, people, photos, header, position, functio n, desturi, connect, fbhost, itrkuri, parentid, nominations, quotes, winners, trivia, awards, catego ry, reviews, dispatches, favorites, features, remove, writers, episodes, overview, appendchild, mysi mon, images, encodeuricomponent, special, createelement, credits, search, lights, summer, caused |
tv.com - rank der domain 1788 (716 in US)
|
| Arts/People/N/Nevin,_Brooke |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/roguespear_pre/ |
| http://www.gamespot.com/features/roguespear_pre/ |
| Preview with screen shots. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, rainbow, return, document, schnurr, itrkid, parentelem, getelementbyid, because, gamespot, changes, success, release, requests, gamers, microsoft, netxp1, desturi, function, parentid, newuri, grenades, ctrkprefix, action, retail, itrkuri, enlarge, become, rbxcprefixed, software, numbers, ch ange, realism, unturned, especially, expecting, legions, sequel, enhance, series, relative, producer , publisher, newcomer, overarching, entertainment, spirit, realistic, either, things, technology |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Shooter/T/Tom_Clancy_Games/Rainbow_Six_Series/Rogue_Spear/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs |
| Exit Release Information for PSP - GameFAQs |
| http://www.gamefaqs.com/portable/psp/data/929800.html |
| Release data and a message board. |
| For Exit on the PSP, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, layout, container, itrkid , interactive, parentelem, nintendo, platforms, gamefaqs, gamespot, genesis, college, designerhirosh i, advertise, abestage, designertomohito, metacritic, software, previews, corporationuljm, miscellan eous, effects, content, submission, itrkuri, beacon, saturn, gamecube, advance, search, arcade, pass word, dreamcast, function, designertohru, newuri, parentid, credits, netxp1, desturi, ctrkprefix, rb xcprefixed, mobile, around, cameras |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Puzzle/Exit |
| zum Seitenanfang ↑ |
| GameFAQs |
| Meteos Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/922233.html |
| Contains information and a message board. |
| For Meteos on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, container, iphone, meteos , gamespot, gamefaqs, parentelem, platforms, nintendo, interactive, beacon, techrepublic, college, s ubmission, review, previews, metacritic, advertise, miscellaneous, content, credits, gamecube, paren tid, search, ctrkprefix, advance, arcade, dreamcast, desturi, rbxcprefixed, netxp1, genesis, newuri, itrkuri, function, saturn, password, bargains, fmmaxprepsmetacritic, solutionsgamespotinternational last, clearance, comchowcnetcnet, comcbsnews, sitesselect, sportscbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Puzzle/Meteos |
| zum Seitenanfang ↑ |
| GameFaqs |
| BloodRayne Cheats, Codes, and Secrets for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/code/542017.html |
| Includes cheat codes and walkthroughs. |
| For BloodRayne on the PC, GameFAQs has 10 cheat codes and secrets. |
| |
| document, imgelem, classname, getelementbyid, playstation, return, message, itrkid, bloodrayne, cont ainer, iphone, gamespot, parentelem, interactive, gamefaqs, nintendo, platforms, function, content, submission, advertise, previews, metacritic, college, cheats, advance, gamecube, itrkuri, parentid, saturn, rbxcprefixed, desturi, newuri, search, password, netxp1, arcade, ctrkprefix, dreamcast, gene sis, beacon, clearance, location, bargains, window, reviews, sitebnetcbs, rankings, comcbssports, ra nkingsvisit, download |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action-Adventure/Survival_Horror/BloodRayne_Series/BloodRayne |
| zum Seitenanfang ↑ |
| GameFAQs |
| Electroplankton Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/926613.html |
| Provides data, and a message board. |
| For Electroplankton on the DS, the GameFAQs information page shows all known release data and credit s. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, gamespot, contain er, electroplankton, interactive, parentelem, nintendo, platforms, gamefaqs, metacritic, advance, ga mecube, review, beacon, submission, college, content, password, search, credits, advertise, itrkuri, parentid, previews, genesis, rbxcprefixed, newuri, desturi, dreamcast, netxp1, function, saturn, ar cade, ctrkprefix, hosting, overstock, clearance, information, comchowcnetcnet, comcbssports, comcbsn ews, solutionsgamespotinternationallast, fmmaxprepsmetacritic, commysimonncaasearch |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Music_and_Dance/Electroplankton |
| zum Seitenanfang ↑ |
| GameFAQs |
| Age of Empires III Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/925735.html |
| Release data and a message board. |
| For Age of Empires III on the PC, the GameFAQs information page shows all known release data and cre dits. |
| |
| imgelem, document, classname, playstation, return, empires, getelementbyid, itrkid, container, iphon e, parentelem, iiimicrosoft, platforms, netxp1, ctrkprefix, studiosx11, itrkuri, parentid, desturi, newuri, rbxcprefixed, advance, 05usage, gamecube, arcade, strategy, gamefaqs, password, dreamcast, n intendo, function, saturn, genesis, idrelease, better, online, dateregionage, datatitlecompanyproduc t, playrelease, rating, studiosesrb, tsystem, ensemble, historicdeveloper, datagenre, requirements, required, headphones, speakers, dorenartdon, pricestitle |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Strategy/Real-Time/Age_of_Empires_Series/Age_of_Empires_III |
| zum Seitenanfang ↑ |
| GameFAQs: Revenant |
| Revenant FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/139180.html |
| Walkthroughs and user reviews. |
| For Revenant on the PC, GameFAQs has 3 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, revenant, gamespo t, container, gamefaqs, parentelem, nintendo, interactive, platforms, itrkuri, beacon, previews, met acritic, college, parentid, content, saturn, faqsfaq, function, search, gamecube, advance, arcade, d reamcast, genesis, rbxcprefixed, ctrkprefix, advertise, password, desturi, netxp1, newuri, comuwirew allstripzdnet, sports, solutionsgamespotinternationallast, cbssports, comtechrepublicthe, comshopper , commoblogicmp3, fmmaxprepsmetacritic, comurbanbaby, commysimonncaasearch, insidertv, cbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/R/Revenant/Cheats_and_Hints |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/freespace2_pre/ |
| http://www.gamespot.com/features/freespace2_pre/ |
| Preview |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, freespace, parentelem, volition, compelling, gamespot, descent, g etelementbyid, original, function, rbxcprefixed, action, innovations, elements, ctrkprefix, parentid , netxp1, itrkuri, desturi, newuri, freespace, destroying, models, without, simple, involving, lates t, exclusive, mysterious, graphics, believable, taking, creating, wingmen, sophisticated, commanding , opposed, interface, excellent, stunning, images, competition, features, solitary, seeming, dogfigh ts, exacerbated, already |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Shooter/D/Descent_Series/FreeSpace_2/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs |
| Time Ace Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/938139.html |
| FAQs, reviews, and a message board. |
| For Time Ace on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, container, parent elem, gamespot, interactive, gamefaqs, nintendo, platforms, insider, beacon, credits, submission, si mulation, content, futuristic, rbxcprefixed, advertise, saturn, function, metacritic, dreamcast, gen esis, password, newuri, parentid, search, itrkuri, release, desturi, gamecube, advance, netxp1, coll ege, ctrkprefix, arcade, comtechrepublicthe, sportscbs, comurbanbaby, insidertv, comshopper, radiocb s, commoblogicmp3, fmmaxprepsmetacritic, commysimonncaasearch |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Simulation/Flight/Time_Ace |
| zum Seitenanfang ↑ |
| GameFAQs |
| Far Cry Vengeance Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/wii/data/934754.html |
| Cheats, reviews, and a message board. |
| For Far Cry Vengeance on the Wii, the GameFAQs information page shows all known release data and cre dits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, vengea nce, gamespot, parentelem, vengeanceubisoftrvl, gamefaqs, interactive, platforms, nintendo, beacon, techrepublic, submission, college, person, shooter, content, credits, action, advertise, netxp1, fun ction, genesis, advance, search, metacritic, password, gamecube, dreamcast, arcade, ctrkprefix, satu rn, itrkuri, parentid, newuri, rbxcprefixed, desturi, gamerankings, comchowcnetcnet, comcbssports, p layers, forums, comshopper, mobile |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/F/Far_Cry_Series/Far_Cry_Vengeance |
| zum Seitenanfang ↑ |
| GameFAQs |
| Zapper FAQs, Walkthroughs, and Guides for PlayStation 2 - GameFAQs |
| http://www.gamefaqs.com/console/ps2/game/561610.html |
| Contains PlayStation 2 walkthrough, with details of bonus stages. |
| For Zapper on the PlayStation 2, GameFAQs has 1 FAQ (game guide/walkthrough). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, zapper , interactive, nintendo, parentelem, gamespot, gamefaqs, platforms, itrkuri, newuri, college, conten t, beacon, parentid, advance, password, function, saturn, search, metacritic, genesis, desturi, rbxc prefixed, ctrkprefix, advertise, gamecube, arcade, dreamcast, netxp1, commysimonncaasearch, comshopp er, comtechrepublicthe, players, cbsnews, cbssports, solutions, international, sports, insidertv, co mmoblogicmp3, comurbanbaby, comuwirewallstripzdnet, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/Z/Zapper |
| zum Seitenanfang ↑ |
| GameFAQs: Theme Park |
| Theme Park Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/573894.html |
| Offers reader reviews for the PlayStation version. |
| For Theme Park on the PlayStation, GameFAQs has 7 reviews. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, gamesp ot, platforms, interactive, parentelem, nintendo, gamefaqs, beacon, content, rollercoaster, metacrit ic, advertise, college, netxp1, function, password, arcade, ctrkprefix, genesis, desturi, dreamcast, itrkuri, saturn, advance, parentid, newuri, reviews, gamecube, search, rbxcprefixed, radiocbs, comm oblogicmp3, fmmaxprepsmetacritic, commysimonncaasearch, comshopper, comtechrepublicthe, solutionsgam espotinternationallast, comchowcnetcnet, sitebnetcbs, sportscbs, comcbsnews, comcbssports, sitessele ct |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Simulation/God_Games/Theme_Games/Theme_Park_Series |
| zum Seitenanfang ↑ |
| GameFAQs: Arc the Lad III |
| Arc the Lad III FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/576155.html |
| Includes walkthroughs and frequently asked questions. |
| For Arc the Lad III on the PlayStation, GameFAQs has 18 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, container, parent elem, gamespot, platforms, gamefaqs, interactive, nintendo, beacon, content, metacritic, walkthrough 12, advertise, college, saturn, function, genesis, advance, search, password, gamecube, dreamcast, a rcade, netxp1, parentid, desturi, rbxcprefixed, ctrkprefix, itrkuri, newuri, sitebnetcbs, previews, reviews, sitesselect, bargains, comcbsnews, solutionsgamespotinternationallast, fmmaxprepsmetacritic , commoblogicmp3, resourcesgame, rankingsvisit, radiocbs, rankings, comcbssports |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad_III |
| zum Seitenanfang ↑ |
| GameFAQs |
| Break 'Em All Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/932722.html |
| Release data and a message board. |
| For Break 'Em All on the DS, the GameFAQs information page shows all known release data and cre dits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, gamespot, itrkid, container, ipho ne, interactive, parentelem, nintendo, platforms, gamefaqs, submission, content, advertise, advance, saturn, beacon, credits, search, password, action, college, gamecube, netxp1, dreamcast, rbxcprefix ed, ctrkprefix, genesis, desturi, arcade, metacritic, itrkuri, function, newuri, parentid, insidertv , sitesselect, radiocbs, comshopper, solutionsgamespotinternationallast, fmmaxprepsmetacritic, commy simonncaasearch, comtechrepublicthe, comchowcnetcnet, sportscbs, commoblogicmp3, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
|
| zum Seitenanfang ↑ |
| GameFAQs |
| Bomberman Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/920766.html |
| Offers information and a message board. |
| For Bomberman on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, container, bomber man, gamespot, interactive, platforms, nintendo, parentelem, gamefaqs, metacritic, content, college, abmp07, credits, hudson, previews, miscellaneous, advertise, password, beacon, function, netxp1, ct rkprefix, gamecube, saturn, genesis, dreamcast, arcade, search, advance, submission, parentid, itrku ri, desturi, newuri, rbxcprefixed, comchowcnetcnet, comcbssports, speakers, radiocbs, laptops, camer as, sportscbs, sitebnetcbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/B/Bomberman_Series/Bomberman_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| Polarium Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/925392.html |
| Contains release data and a message board. |
| For Polarium on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, gamespot, itrkid, contain er, polarium, interactive, graphic, parentelem, nintendo, platforms, gamefaqs, credits, submission, previews, content, designshoichi, american, programmingakihiro, kumagaimain, koikesound, advertise, designmikako, asnp03, college, metacritic, designdaisuke, miscellaneous, dreamcast, arcade, genesis, newuri, parentid, search, advance, netxp1, desturi, rbxcprefixed, ctrkprefix, function, saturn, itr kuri, gamecube, beacon, password, laptops |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Puzzle/Polarium |
| zum Seitenanfang ↑ |
| GameFAQs |
| Seed Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/931232.html |
| Release data and a message board. |
| For Seed on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, intera ctive, parentelem, gamefaqs, nintendo, gamespot, platforms, beacon, advertise, college, content, met acritic, submission, massively, playing, multiplayer, online, netxp1, arcade, dreamcast, gamecube, c trkprefix, search, advance, desturi, genesis, saturn, function, newuri, rbxcprefixed, password, itrk uri, parentid, fmmaxprepsmetacritic, players, location, digital, phones, commoblogicmp3, commysimonn caasearch, comurbanbaby, comuwirewallstripzdnet, sports |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/Massive_Multiplayer_Online/Seed |
| zum Seitenanfang ↑ |
| GameFAQs |
| Daemonica Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/926011.html |
| Release data, and a message board. |
| For Daemonica on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, daemonica, container, itrkid, iph one, compliant, directx, parentelem, gamefaqs, gamespot, cbsiadglobal, interactive, nintendo, platfo rms, genesis, netxp1, college, arcade, gamecube, advance, person, search, content, support, adventur e, dreamcast, submission, newuri, beacon, metacritic, advertise, parentid, itrkuri, saturn, desturi, rbxcprefixed, ctrkprefix, password, function, solutionsgamespotinternationallast, fmmaxprepsmetacri tic, mobile, comchowcnetcnet, commoblogicmp3, gamerankings, comcbssports |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action-Adventure/D/Daemonica |
| zum Seitenanfang ↑ |
| TV.com: Amanda Seyfried |
| Amanda Seyfried on TV.com |
| http://www.tv.com/amanda-seyfried/person/143056/summary.html |
| Biography, roles and appearances, and forum. |
| |
| Amanda Seyfried, , photos, videos, life, biography, career, credits |
| imgelem, return, document, videos, itrkid, amanda, background, parentelem, getelementbyid, seyfried, parentid, newuri, itrkuri, netxp1, function, desturi, photos, people, ctrkprefix, rbxcprefixed, hea der, height, adinfo, features, position, quotes, reviews, trivia, overview, credits, lights, favorit es, remove, earrings, images, appendchild, encodeuricomponent, createelement, search, diamond, summe r, mysimon, lights, common, special, center, disabled, javascript, result, import, enabled |
tv.com - rank der domain 1788 (716 in US)
|
| Arts/Performing_Arts/Acting/Actors_and_Actresses/S/Seyfried,_Amanda |
| zum Seitenanfang ↑ |
| TV.com: Robert O. Smith |
| Robert O. Smith on TV.com |
| http://www.tv.com/robert-o-smith/person/101499/summary.html |
| The television reference guide includes credits for Robert O. |
| |
| Robert O. Smith, , photos, videos, life, biography, career, credits |
| imgelem, document, return, videos, itrkid, getelementbyid, parentelem, robert, desturi, function, rb xcprefixed, ctrkprefix, parentid, newuri, itrkuri, connect, fbhost, photos, people, netxp1, awards, category, lights, winners, search, episodes, images, trivia, credits, overview, quotes, reviews, fav orites, remove, protagonists, pantless, createelement, gamefaqs, appendchild, height, encodeuricompo nent, unescape, 3cscript, static, facebook, featureloader, protocol, location, region, secure, 12792 87803 |
tv.com - rank der domain 1788 (716 in US)
|
| Arts/Animation/Voice_Actors/S/Smith,_Robert_O. |
| zum Seitenanfang ↑ |
| GameSpot |
| NASCAR 2005: Chase for the Cup Impressions - Xbox Previews at GameSpot |
| http://www.gamespot.com/xbox/driving/nascarthunder2005/preview_6102792.html |
| Previewed by Jason Ocampo. Includes gameplay movie. [Xbox] |
| EA is completely overhauling its NASCAR series with its next installment. Learn all about the signif icant changes it's undergoing. |
| |
| nascar, imgelem, document, return, getelementbyid, versions, driver, racing, points, itrkid, gamespo t, console, season, version, score8, behind, parentelem, images, system, someone, sports, reviews, i ntimidator, addition, changes, prices, feature, series, newuri, desturi, ctrkprefix, rbxcprefixed, p arentid, itrkuri, netxp1, player, easily, previews, impressions, modified, function, circuit, review , another, because, studio, should, comment, newman, against, rsaquo |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Driving_and_Racing/Simulations/NASCAR_Games/NASCAR_Series/NASCAR_2005_-_Chase_for_the_Cup/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs |
| Crysis Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/931665.html |
| Release data, and a message board. |
| For Crysis on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, container, cbsiadglobal, iphone, parentelem, platforms, shooter, ctrkprefix, action, desturi, person, parentid, itrkuri, newu ri, rbxcprefixed, function, netxp1, dreamcast, genesis, gamecube, gamefaqs, password, advance, arcad e, saturn, nintendo, takeover, global, cookie, gfebforcestreaming, firstpage, detect, undefined, tak eover, typeof, msystem, gamesanswersboardcheck, ficrysishomedatafaqscheatsreviewsimagesvideosmy, pri cestitle, datagenre, crytekesrb, fideveloper, rating, requirements, gamefaqs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/C/Crysis |
| zum Seitenanfang ↑ |
| GameSpot's Circle of Blood Walkthrough |
| GameSpot - /features/circle/ |
| http://www.gamespot.com/features/circle/ |
| Complete path through game. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, george, parentelem, gamespot, getelementbyid, getting, through, h istory, rbxcprefixed, desturi, ctrkprefix, function, information, netxp1, french, murder, newuri, an other, itrkuri, parentid, ireland, several, locations, nevertheless, motivation, approaching, closes t, layers, puzzles, circle, conversations, canyon, flavors, investigator, branches, conversational, richer, contacts, different, determine, liberally, detailed, questions, responses, particular, topic s, affect, sources |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Broken_Sword_Series/Broken_Sword_-_The_Shadow_of_the_Templars |
| zum Seitenanfang ↑ |
| GameFAQs |
| Final Fantasy VIII Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/197343.html |
| A collection of submitted reviews by users. |
| For Final Fantasy VIII on the PlayStation, GameFAQs has 113 reviews. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, container, iphone, parent elem, platforms, desturi, rbxcprefixed, advance, newuri, ctrkprefix, parentid, fantasy, itrkuri, pas sword, gamefaqs, netxp1, dreamcast, nintendo, genesis, arcade, gamecube, function, saturn, gamefaqs, firstpage, jumper, cookie, domain, viiihomedatafaqscheatssavesreviewsimagesvideosmy, aganar10, squa resoft, reviewswow, detailed, console, playing, rpgfinal, pricesgamefaqs, gamesanswersboardcheck, pl atform, leader, appendchild, height, createelement, forgot, search |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/F/Final_Fantasy_Games/Final_Fantasy_VIII/Reviews_and_Previews/PlayStation |
| zum Seitenanfang ↑ |
| GameFAQs: Ultima III |
| Ultima III: Exodus FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/562659.html |
| Walkthrough. |
| For Ultima III: Exodus on the PC, GameFAQs has 8 FAQs (game guides and walkthroughs). |
| |
| document, imgelem, classname, playstation, return, getelementbyid, iphone, itrkid, container, gamesp ot, interactive, parentelem, nintendo, ultima, platforms, gamefaqs, exodus, saturn, beacon, search, advance, gamecube, password, content, college, advertise, metacritic, genesis, rbxcprefixed, ctrkpre fix, function, netxp1, desturi, dreamcast, arcade, parentid, itrkuri, newuri, fmmaxprepsmetacritic, commysimonncaasearch, insidertv, commoblogicmp3, cbsnews, sports, comurbanbaby, comtechrepublicthe, comshopper, comuwirewallstripzdnet, cbssports, laptops, speakers |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/U/Ultima_Series/Ultima_III_-_Exodus |
| zum Seitenanfang ↑ |
| GameFAQs |
| Perimeter Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/914468.html |
| Cheats, reviews, and a message board. |
| For Perimeter on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, perime ter, gamespot, nintendo, platforms, parentelem, gamefaqs, interactive, metacritic, submission, adver tise, credits, college, strategy, content, beacon, saturn, function, netxp1, advance, search, passwo rd, gamecube, arcade, genesis, dreamcast, ctrkprefix, parentid, newuri, itrkuri, previews, rbxcprefi xed, desturi, fmmaxprepsmetacritic, solutionsgamespotinternationallast, clearance, bargains, commobl ogicmp3, around, rankings, radiocbs, reviews, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Strategy/Real-Time/Perimeter_Series/Perimeter |
| zum Seitenanfang ↑ |
| GameFAQs |
| Crimson Skies FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/914280.html |
| Walkthrough and codes. |
| For Crimson Skies on the PC, GameFAQs has 2 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, crimson, containe r, gamespot, interactive, parentelem, nintendo, platforms, gamefaqs, search, advance, beacon, arcade , password, gamecube, advertise, metacritic, function, previews, content, college, saturn, newuri, p arentid, rbxcprefixed, desturi, ctrkprefix, itrkuri, dreamcast, netxp1, genesis, cbssports, comcbssp orts, comchowcnetcnet, comcbsnews, sportscbs, radiocbs, cbsnews, solutionsgamespotinternationallast, commysimonncaasearch, comshopper, comtechrepublicthe, insidertv, commoblogicmp3 |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/C/Crimson_Skies_Series/Crimson_Skies |
| zum Seitenanfang ↑ |
| GameFAQs |
| 1701 A.D. Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/932832.html |
| Release data, and a message board. |
| For 1701 A.D. on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, container, iphone, itrkid, intera ctive, gamefaqs, gamespot, parentelem, platforms, nintendo, credits, designerdirk, designersebastian , college, content, advertise, metacritic, strategy, beacon, genesis, function, dreamcast, submissio n, password, release, search, arcade, gamecube, advance, saturn, ctrkprefix, itrkuri, rbxcprefixed, netxp1, desturi, parentid, newuri, hosting, overstock, gameplay, phones, digital, cameras, laptops, speakers, bargains |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Strategy/Real-Time/Anno_Series/1701 |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/dung2_int/ |
| http://www.gamespot.com/features/dung2_int/ |
| Interview and screen shots. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, gamespot, itrkid, keeper, parentelem, dungeon, better, features, geteleme ntbyid, player, original, opponent, enlarge, desturi, rbxcprefixed, newuri, itrkuri, parentid, ctrkp refix, netxp1, function, goldsworthy, another, attract, creatures, combat, underestimated, creature, another, feature, overpowers, determined, possible, playable, importantly, balancing, redesigning, multiplayer, turned, multiplayer, server, experience, central, playing, entice, angels, supply, knig hts, counteract |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Strategy/Real-Time/Dungeon_Keeper_Series/Dungeon_Keeper_2 |
| zum Seitenanfang ↑ |
| GameFAQs |
| Wii Play Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/wii/data/935589.html |
| FAQs, cheats, reviews, and a message board. |
| For Wii Play on the Wii, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, container, ninten do, interactive, gamespot, gamefaqs, parentelem, platforms, techrepublic, submission, content, colle ge, rhap12, playnintendorvl, metacritic, wiinintendorvl, miscellaneous, system, previews, shibataui, advertise, remote, nintendorvl, itrkuri, beacon, saturn, function, genesis, password, search, advan ce, dreamcast, arcade, gamecube, parentid, newuri, credits, ctrkprefix, netxp1, rbxcprefixed, destur i, gamerankings, speakers, mobile |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/W/Wii_Play |
| zum Seitenanfang ↑ |
| GameFAQs |
| War Rock Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/931206.html |
| FAQs, reviews, and a message board. |
| For War Rock on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, container, ninten do, gamefaqs, gamespot, interactive, platforms, parentelem, beacon, submission, action, person, shoo ter, advertise, credits, content, saturn, function, genesis, advance, search, gamecube, arcade, drea mcast, parentid, rbxcprefixed, desturi, newuri, itrkuri, college, metacritic, netxp1, ctrkprefix, pa ssword, insidertv, fmmaxprepsmetacritic, comtechrepublicthe, commoblogicmp3, radiocbs, comchowcnetcn et, comcbssports, comshopper, comcbsnews, solutionsgamespotinternationallast |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/W/War_Rock |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/bestworst96/ |
| http://www.gamespot.com/features/bestworst96/ |
| Picks for the best and worst of 1996. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, gamespot, parentelem, getelementbyid, gaming, winners, ctrkprefix , rbxcprefixed, function, netxp1, desturi, itrkuri, newuri, parentid, originality, effectively, inno vative, between, greater, things, technology, sequels, improvement, explosion, multiplayer, countere d, blockbuster, continued, demanded, strategy, category, surprisingly, enough, serious, section, con tenders, included, threat, victor, winner, declared, details, writers, contributing, awards, determi ne, ballots, tallied |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/News_and_Reviews/Awards/1996 |
| zum Seitenanfang ↑ |
| GameFAQs |
| SWAT 4 Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/920508.html |
| FAQs, cheats, reviews, and a message board. |
| For SWAT 4 on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, engine, playstation, classname, return, getelementbyid, iphone, itrkid, container , officer, gamespot, interactive, parentelem, platforms, gamefaqs, nintendo, content, submission, se arch, gamecube, advance, function, credits, action, entertainment04, shooter, 4sierra, person, netxp 1, metacritic, password, review, previews, advertise, parentid, saturn, itrkuri, college, ctrkprefix , desturi, rbxcprefixed, newuri, dreamcast, arcade, beacon, genesis, mobile, around, digital, moviet ome |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Police_Quest_Series/SWAT_Series/SWAT_4 |
| zum Seitenanfang ↑ |
| GameFAQs |
| Picross DS Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/936532.html |
| FAQs, cheats, reviews, and a message board. |
| For Picross DS on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, dsnintendontr, getelementbyid, picross, itrkid, i phone, container, platforms, interactive, parentelem, gamefaqs, nintendo, gamespot, beacon, credits, college, metacritic, puzzle, advertise, password, newuri, saturn, miscellaneous, genesis, gamecube, advance, arcade, dreamcast, function, desturi, rbxcprefixed, itrkuri, parentid, content, submission , search, ctrkprefix, netxp1, phones, players, sitebnetcbs, bargains, sitesselect, radiocbs, sportsc bs, clearance, laptops |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Puzzle/Picross_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| Heatseeker Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/wii/data/935985.html |
| FAQs, cheats, images, and a message board. |
| For Heatseeker on the Wii, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, gamespot, heatseeker, iphone, con tainer, itrkid, nintendo, parentelem, interactive, platforms, gamefaqs, beacon, simulation, credits, college, modern, content, flight, submission, previews, saturn, advertise, function, genesis, searc h, password, metacritic, advance, gamecube, dreamcast, arcade, netxp1, itrkuri, rbxcprefixed, destur i, ctrkprefix, newuri, parentid, fmmaxprepsmetacritic, commoblogicmp3, sitemap, solutionsgamespotint ernationallast, movietome, insidertv, comurbanbaby, comuwirewallstripzdnet |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Simulation/Flight/Heatseeker |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/1999/ |
| http://www.gamespot.com/features/1999/ |
| Picks for the best and worst of 1999. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, gamespot, itrkid, getelementbyid, difficult, parentelem, released, surpas s, newuri, excellent, ctrkprefix, function, rbxcprefixed, netxp1, itrkuri, parentid, desturi, qualit y, freespace, starcraft, matched, number, disappoint, seemed, doomed, appeared, included, unlikely, developers, fandango, readers, choice, awards, selections, presents, ballot, disagree, category, pro ved, homeworld, racing, empires, select, representative, surprise, though, selection, nascar, select ing |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/News_and_Reviews/Awards/1999 |
| zum Seitenanfang ↑ |
| GameFAQs |
| Zoo Tycoon 2 Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/919850.html |
| Cheats, reviews, and a message board. |
| For Zoo Tycoon 2 on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, tycoon, classname, playstation, return, getelementbyid, iphone, container, itrkid , gamespot, 2microsoft, interactive, parentelem, nintendo, gamefaqs, platforms, advance, strategy, c ontent, metacritic, beacon, gamecube, college, submission, previews, credits, password, ctrkprefix, saturn, function, advertise, netxp1, genesis, dreamcast, itrkuri, arcade, studios11, parentid, destu ri, rbxcprefixed, newuri, search, comchowcnetcnet, movietome, solutionsgamespotinternationallast, co murbanbaby, comuwirewallstripzdnet, sports, gamerankings, comcbssports |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Simulation/God_Games/Tycoon_Games/Zoo_Tycoon_Series/Zoo_Tycoon_2 |
| zum Seitenanfang ↑ |
| GameFAQs |
| SimCity DS Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/935403.html |
| Cheats, reviews, images, and a message board. |
| For SimCity DS on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, artsntr, containe r, simcity, platforms, parentelem, interactive, gamefaqs, dselectronic, gamespot, nintendo, techrepu blic, strategy, college, content, beacon, advertise, submission, metacritic, building, credits, dest uri, genesis, advance, netxp1, gamecube, function, parentid, itrkuri, saturn, newuri, search, rbxcpr efixed, ctrkprefix, arcade, dreamcast, password, sitesselect, sportscbs, sitebnetcbs, comcbssports, comshopper, comtechrepublicthe, insidertv |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Simulation/God_Games/Sim_Games/SimCity_Series/SimCity_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| X3: Reunion Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/927012.html |
| FAQs, cheats, and a message board. |
| For X3: Reunion on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, reunion, return, getelementbyid, iphone, container, games pot, itrkid, content, parentelem, nintendo, gamefaqs, interactive, platforms, simulation, advertise, metacritic, college, beacon, previews, programmingsebastian, credits, submission, edition, function , arcade, saturn, search, advance, newuri, dreamcast, gamecube, parentid, itrkuri, desturi, netxp1, password, genesis, rbxcprefixed, ctrkprefix, players, phones, sitebnetcbs, sportscbs, digital, sites select, laptops, clearance |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/Space_Combat/X_Series/X3_-_Reunion |
| zum Seitenanfang ↑ |
| GameFAQs |
| Spore Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/926714.html |
| Information, links, and a message board. |
| For Spore on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, games09, getelementbyid, container, itrkid, iphon e, engineer, gamefaqs, parentelem, gamespot, edition, interactive, platforms, galactic, nintendo, be acon, strategy, advertise, breeding, metacritic, credits, parentid, genesis, function, content, satu rn, dreamcast, arcade, submission, password, release, college, gamecube, advance, search, rbxcprefix ed, review, newuri, desturi, itrkuri, netxp1, previews, ctrkprefix, bargains, players, sitesselect, digital |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Simulation/God_Games/Spore |
| zum Seitenanfang ↑ |
| GameFAQs PSP |
| Sticky Balls Release Information for PSP - GameFAQs |
| http://www.gamefaqs.com/portable/psp/data/920837.html |
| Data and a message board. |
| For Sticky Balls on the PSP, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, sticky, container , platforms, gamefaqs, parentelem, gamespot, nintendo, interactive, submission, gamecube, advertise, college, advance, beacon, content, miscellaneous, newuri, saturn, function, dreamcast, genesis, met acritic, desturi, rbxcprefixed, parentid, arcade, search, password, netxp1, ctrkprefix, itrkuri, sol utionsgamespotinternationallast, sports, comurbanbaby, comuwirewallstripzdnet, insidertv, comtechrep ublicthe, fmmaxprepsmetacritic, commoblogicmp3, commysimonncaasearch, comshopper, cbsnews, digital |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Puzzle/Sticky_Balls |
| zum Seitenanfang ↑ |
| GameFAQs |
| I of the Dragon Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/544184.html |
| FAQs, cheats, and a message board. |
| For I of the Dragon on the PC, the GameFAQs information page shows all known release data and credit s. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, dragon , nintendo, metacritic, gamefaqs, interactive, platforms, gamespot, parentelem, movies, direct3d, pl aying, advertise, college, content, beacon, higher, credits, submission, compatible, saturn, netxp1, ctrkprefix, newuri, parentid, desturi, rbxcprefixed, password, gamecube, advance, arcade, dreamcast , search, genesis, itrkuri, function, release, comcbsnews, comscore, 3000023, radiocbs, sitebnetcbs, sportscbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/I/I_of_the_Dragon |
| zum Seitenanfang ↑ |
| GameFAQs |
| Rayman DS Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/924893.html |
| Data, cheats, reviews, and a message board. |
| For Rayman DS on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, rayman, iphone, container, itrkid , gamespot, interactive, parentelem, nintendo, gamefaqs, platforms, college, metacritic, credits, pa ssword, beacon, gamecube, action, submission, content, search, advance, dsubisoftntr, genesis, rbxcp refixed, netxp1, advertise, saturn, ctrkprefix, desturi, arcade, function, dreamcast, itrkuri, newur i, parentid, comchowcnetcnet, movietome, comcbssports, insidertv, comcbsnews, comurbanbaby, comuwire wallstripzdnet, comtechrepublicthe, gamerankings, fmmaxprepsmetacritic |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Platform/Rayman_Series/Rayman_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| AquaNox Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/447287.html |
| Provides information, help, codes, and a message board. |
| For AquaNox on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, aquanox, parentelem, platforms, interactive, gamefaqs, nintendo, advertise, beacon, college, sim ulation, password, futuristic, previews, submission, credits, itrkuri, saturn, function, dreamcast, arcade, genesis, desturi, newuri, metacritic, parentid, rbxcprefixed, netxp1, content, search, gamec ube, ctrkprefix, advance, comshopper, comtechrepublicthe, sitesselect, comcbsnews, comcbssports, com chowcnetcnet, solutionsgamespotinternationallast, radiocbs, fmmaxprepsmetacritic |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/A/AquaNox_Series/AquaNox |
| zum Seitenanfang ↑ |
| GameFAQs |
| Red Steel Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/revolution/data/932528.html |
| Release data, and a message board. |
| For Red Steel on the Wii, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, steelu bisoftrvl, parentelem, gamespot, gamefaqs, interactive, platforms, nintendo, techrepublic, submissio n, advertise, metacritic, action, credits, college, redp12, content, shooter, person, beacon, search , advance, gamecube, function, netxp1, arcade, genesis, dreamcast, saturn, rbxcprefixed, ctrkprefix, review, newuri, previews, parentid, itrkuri, password, desturi, solutionsgamespotinternationallast, comcbssports, comchowcnetcnet, rankings, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/R/Red_Steel |
| zum Seitenanfang ↑ |
| GameFAQs |
| 25 to Life Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/926658.html |
| Provides release data and a message board. |
| For 25 to Life on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, gamefaqs, interactive, platforms, nintendo, parentelem, action, shooter, advertise, college, con tent, beacon, metacritic, previews, credits, submission, person, detective, dreamcast, arcade, newur i, function, saturn, itrkuri, gamecube, advance, netxp1, search, password, ctrkprefix, desturi, rbxc prefixed, parentid, genesis, gameplay, speakers, bargains, clearance, screenshots, hosting, overstoc k, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/2/25_to_Life |
| zum Seitenanfang ↑ |
| GameFAQs |
| Faces of War Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/928184.html |
| Release data and a message board. |
| For Faces of War on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, container, itrkid, iphone, gamesp ot, warubisoft09, gamefaqs, parentelem, interactive, nintendo, platforms, beacon, content, submissio n, previews, metacritic, advertise, strategy, credits, college, rbxcprefixed, ctrkprefix, netxp1, dr eamcast, arcade, search, desturi, gamecube, genesis, saturn, function, newuri, advance, parentid, pa ssword, itrkuri, comchowcnetcnet, comcbssports, radiocbs, sportscbs, sitemap, comcbsnews, commysimon ncaasearch, comshopper, comtechrepublicthe, commoblogicmp3 |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Strategy/Real-Time/Faces_of_War |
| zum Seitenanfang ↑ |
| GameFAQs |
| Zoo Keeper Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/924607.html |
| Contains information, FAQs, cheats, and a message board. |
| For Zoo Keeper on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, keeper, getelementbyid, itrkid, iphone, container , gamespot, platforms, interactive, keeperignition, gamefaqs, entertainmentntr, parentelem, nintendo , miscellaneous, advertise, college, content, beacon, metacritic, credits, azkp03, submission, passw ord, function, netxp1, newuri, parentid, desturi, rbxcprefixed, saturn, arcade, gamecube, dreamcast, genesis, advance, search, itrkuri, ctrkprefix, comscore, bargains, forgot, clearance, speakers, hos ting, overstock, sitesselect |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Puzzle/Zoo_Keeper |
| zum Seitenanfang ↑ |
| First look: Smash Cars at GameSpot |
| First look: Smash Cars - PlayStation 2 News at GameSpot |
| http://www.gamespot.com/ps2/driving/smashcars/news_6029530.html |
| By Justin Calvert. Includes screen shots. |
| Metro3D releases information on its toy-car racing game for the PlayStation 2. First screens inside. |
| |
| imgelem, document, return, getelementbyid, gamespot, racing, images, itrkid, review, playstation, pa rentelem, metro3d, information, released, gameplay, player, looked, score6, different, around, curre ntly, feature, reviews, prices, players, newuri, itrkuri, studio, ctrkprefix, netxp1, parentid, func tion, rbxcprefixed, desturi, system, rating, reviewsuser, armageddon, innerhtml, 2goodcritic, factio n, comments, refresh, comments, available, becomes, comment, global, 6029530, answers, videos |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Driving_and_Racing/Simulations/Smash_Cars |
| zum Seitenanfang ↑ |
| GameFAQs |
| RF Online Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/929559.html |
| Release data and a message board. |
| For RF Online on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, online, return, getelementbyid, itrkid, iphone, container , platforms, gamefaqs, interactive, parentelem, nintendo, gamespot, college, metacritic, submission, playing, massively, credits, multiplayer, onlinecodemasters02, beacon, advertise, parentid, saturn, function, advance, password, search, gamecube, arcade, genesis, dreamcast, newuri, previews, itrkur i, content, ctrkprefix, netxp1, desturi, rbxcprefixed, comcbsnews, fmmaxprepsmetacritic, radiocbs, s portscbs, bargains, commoblogicmp3, comchowcnetcnet |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/Massive_Multiplayer_Online/RF_Online |
| zum Seitenanfang ↑ |
| GameFAQs |
| Warpath Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/562898.html |
| Release data and a message board. |
| For Warpath on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, warpat h, gamefaqs, nintendo, cbsiadglobal, parentelem, platforms, interactive, gamespot, action, advertise , college, content, beacon, metacritic, person, digital, credits, submission, shooter, search, genes is, saturn, netxp1, ctrkprefix, desturi, password, newuri, itrkuri, parentid, rbxcprefixed, dreamcas t, gamecube, arcade, advance, function, solutionsgamespotinternationallast, fmmaxprepsmetacritic, sp orts, comchowcnetcnet, comcbssports, commoblogicmp3, commysimonncaasearch |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/W/WarPath |
| zum Seitenanfang ↑ |
| GameFAQs |
| Infernal Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/926226.html |
| Provides release data and a message board. |
| For Infernal on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, gamespot, iphone, container, itrk id, infernal, interactive, microsoft, cbsiadglobal, parentelem, character, nintendo, gamefaqs, platf orms, action, shooter, person, search, rights, advance, gamecube, genesis, dreamcast, arcade, colleg e, credits, password, previews, submission, ctrkprefix, metacritic, artistpiotr, artist, artistlukas z, advertise, content, windows, desturi, rbxcprefixed, beacon, newuri, saturn, itrkuri, parentid, ne txp1, function |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action/I/Infernal |
| zum Seitenanfang ↑ |
| GameFAQs |
| The Witcher Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/915112.html |
| Release data, and a message board. |
| For The Witcher on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, witcher, return, design, getelementbyid, container, iphon e, itrkid, gamespot, edition, parentelem, cbsiadglobal, nintendo, gamefaqs, interactive, platforms, previews, 07usthe, gameplay, credits, metacritic, collector, advertise, content, madejgameplay, witc heratari10, playing, action, 07euthe, itrkuri, beacon, advance, gamecube, search, function, saturn, genesis, dreamcast, arcade, 07authe, parentid, password, college, newuri, ctrkprefix, netxp1, rbxcpr efixed, desturi |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/W/Witcher,_The |
| zum Seitenanfang ↑ |
| GameFAQs |
| Scratches Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/931243.html |
| Release data and a message board. |
| For Scratches on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, scratches, contai ner, gamespot, interactive, parentelem, gamefaqs, nintendo, platforms, submission, search, credits, entertainment03, gamecube, college, techrepublic, metacritic, advertise, password, advance, beacon, ctrkprefix, genesis, saturn, function, netxp1, content, rbxcprefixed, arcade, dreamcast, itrkuri, 07 euscratches, parentid, adventure, newuri, desturi, hosting, overstock, speakers, sitebnetcbs, sports cbs, radiocbs, comcbssports, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Scratches |
| zum Seitenanfang ↑ |
| GameFAQs |
| UberSoldier Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/930965.html |
| Release data and a message board. |
| For UberSoldier on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, gamespot, contain er, ubersoldier, platforms, interactive, gamefaqs, nintendo, parentelem, person, compatible, beacon, credits, college, metacritic, submission, action, shooter, password, saturn, function, dreamcast, a rcade, genesis, netxp1, advertise, newuri, gamecube, desturi, parentid, software03, itrkuri, rbxcpre fixed, advance, search, ctrkprefix, content, fmmaxprepsmetacritic, solutionsgamespotinternationallas t, insidertv, comshopper, comtechrepublicthe, comuwirewallstripzdnet, commysimonncaasearch |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/U/ÜberSoldier |
| zum Seitenanfang ↑ |
| GameFAQs |
| TimeShift Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/925761.html |
| Release data and a message board. |
| For TimeShift on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, container, iphone, timesh ift, gamespot, parentelem, nintendo, interactive, gamefaqs, platforms, content, college, entertainme nt11, actorscott, shooter, previews, mccormick, entertainment10, advertise, windows, metacritic, per son, scriptmichael, action, submission, function, rbxcprefixed, ctrkprefix, netxp1, password, search , credits, advance, gamecube, genesis, dreamcast, arcade, desturi, saturn, parentid, beacon, itrkuri , newuri, clearance, players |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/T/TimeShift |
| zum Seitenanfang ↑ |
| GameFAQs |
| BioShock Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/924919.html |
| Release data and a message board. |
| For BioShock on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, games08, return, getelementbyid, iphone, itrkid, bioshock , container, gamefaqs, gamespot, interactive, platforms, nintendo, parentelem, shooter, submission, beacon, credits, metacritic, advertise, action, college, function, previews, gamecube, saturn, genes is, advance, netxp1, itrkuri, parentid, person, content, edition, newuri, rbxcprefixed, ctrkprefix, dreamcast, password, arcade, desturi, search, comcbsnews, solutionsgamespotinternationallast, comcho wcnetcnet, comcbssports, speakers, radiocbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/B/BioShock_Series/BioShock |
| zum Seitenanfang ↑ |
| GameFAQs |
| Gothic 3 Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/920920.html |
| Release data, and a message board. |
| For Gothic 3 on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, iphone, gothic, itrkid , design, gamespot, gamefaqs, interactive, parentelem, platforms, nintendo, beacon, 06eugothic, cred its, metacritic, advertise, playing, entertainment, parentid, genesis, function, saturn, dreamcast, college, password, submission, arcade, gamecube, advance, search, itrkuri, newuri, previews, desturi , content, rbxcprefixed, netxp1, designmario, ctrkprefix, players, clearance, bargains, digital, spe akers, sitebnetcbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/G/Gothic_Series/Gothic_III |
| zum Seitenanfang ↑ |
| Gamefaqs Suikoden 3 |
| Suikoden III FAQs, Walkthroughs, and Guides for PlayStation 2 - GameFAQs |
| http://www.gamefaqs.com/console/ps2/game/536777.html |
| Source for all walkthroughs and faqs. |
| For Suikoden III on the PlayStation 2, GameFAQs has 36 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, walkthrough, getelementbyid, gamespot, iphone, co ntainer, guide01, itrkid, suikoden, interactive, parentelem, nintendo, gamefaqs, platforms, content, metacritic, 03clara1, gamecube, ctrkprefix, advance, spanish, password, 02starvenus1, search, colle ge, previews, crenshaw1, faqsfaq, newuri, saturn, itrkuri, desturi, rbxcprefixed, netxp1, function, parentid, dreamcast, advertise, destiny, genesis, arcade, beacon, around, digital, phones, movietome , players |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/S/Suikoden_Series/Suikoden_III/Cheats_and_Hints |
| zum Seitenanfang ↑ |
| GameFAQs: El-Fish |
| El-Fish FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/577125.html |
| Includes frequently asked questions and strategy guide. |
| For El-Fish on the PC, GameFAQs has 1 FAQ (game guide/walkthrough). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, container, gamesp ot, interactive, nintendo, gamefaqs, platforms, parentelem, parentid, strategy, metacritic, content, newuri, college, beacon, itrkuri, dreamcast, genesis, arcade, advance, search, gamecube, password, advertise, function, netxp1, ctrkprefix, desturi, rbxcprefixed, saturn, international, clearance, ma xpreps, sports, speakers, solutions, hosting, cbssports, overstock, cbsnews, fmmaxprepsmetacritic, s itebnetcbs, sportscbs, radiocbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Simulation/Life_Games/El-Fish |
| zum Seitenanfang ↑ |
| GameFAQs |
| War Times Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/914817.html |
| Release data, FAQs, and a message board. |
| For War Times on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, container, iphone, parent elem, gamefaqs, nintendo, interactive, gamespot, platforms, beacon, submission, previews, college, m etacritic, advertise, strategy, content, ctrkprefix, dreamcast, genesis, rbxcprefixed, desturi, sear ch, advance, gamecube, netxp1, saturn, function, newuri, arcade, itrkuri, parentid, password, comcho wcnetcnet, comcbssports, comcbsnews, sitemap, comtechrepublicthe, insidertv, comurbanbaby, comuwirew allstripzdnet, comshopper, commysimonncaasearch, solutionsgamespotinternationallast, fmmaxprepsmetac ritic |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Strategy/Real-Time/War_Times |
| zum Seitenanfang ↑ |
| GameFAQs |
| D FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/572426.html |
| Offers FAQs and walkthroughs with links to codes and hints. |
| For D on the PlayStation, GameFAQs has 4 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, gamesp ot, nintendo, interactive, platforms, gamefaqs, parentelem, parentid, itrkuri, walkthrough, advertis e, college, content, beacon, metacritic, newuri, function, search, gamecube, advance, saturn, genesi s, rbxcprefixed, arcade, ctrkprefix, netxp1, dreamcast, desturi, password, sports, comurbanbaby, mys imon, comuwirewallstripzdnet, moblogic, solutions, maxpreps, international, cbssports, cbsnews, solu tionsgamespotinternationallast, bargains, guides, sitesselect |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action-Adventure/Survival_Horror/D_Series/D |
| zum Seitenanfang ↑ |
| TV.com - Matt Doran |
| Matt Doran on TV.com |
| http://www.tv.com/matt-doran/person/14126/summary.html |
| Includes the actor's biography, roles and appearances, and news. |
| |
| Matt Doran, , photos, videos, life, biography, career, credits |
| document, imgelem, return, itrkid, videos, params, interactive, getelementbyid, search, parentelem, function, rbxcprefixed, desturi, netxp1, ctrkprefix, pagetracker, gajshost, pageparams, college, met acritic, itrkuri, parentid, reviews, domain, newuri, cookie, connect, protocol, script, unescape, 3c script, javascript, location, fbhost, people, photos, sports, baseball, fantasy, phones, rights, res erved, privacy, advertise, popular, entertainment, 9ecec4fd9dbc407e5d9b83aa0eb89270, urbanbaby, maxp reps, cbssports, moneywatch |
tv.com - rank der domain 1788 (716 in US)
|
| Arts/Performing_Arts/Acting/Actors_and_Actresses/D/Doran,_Matt |
| zum Seitenanfang ↑ |
| GameFAQs |
| Nanostray 2 for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/home/935401.html |
| Release data, FAQs, cheats, reviews, images, and a message board. |
| For Nanostray 2 on the DS, GameFAQs has 1 FAQ (game guide/walkthrough), 5 cheat codes and secrets, a nd 3 reviews. |
| |
| imgelem, document, playstation, classname, nanostray, return, gamefaqs, getelementbyid, itrkid, cont ainer, iphone, gamespot, interactive, parentelem, cheats, metacritic, nintendo, platforms, shooter, genesis, reviews, password, questions, content, college, advance, gamecube, arcade, guides, unlock, ctrkprefix, dreamcast, search, advertise, previews, itrkuri, screenshots, function, beacon, parentid , desturi, rbxcprefixed, netxp1, movies, answers, saturn, newuri, rankingsvisit, rankings, stories, sportscbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/N/Nanostray_Series/Nanostray_2 |
| zum Seitenanfang ↑ |
| TV.com: Lea Salonga |
| Lea Salonga on TV.com |
| http://www.tv.com/lea-salonga/person/92158/summary.html |
| With biography and acting appearances on TV. |
| Discography :
Small Voice (1981)
Lea (1988)
Lea Salonga (1993)
I'd Like to Teach.. . |
| Lea Salonga, , photos, videos, life, biography, career, credits |
| imgelem, document, return, itrkid, videos, getelementbyid, parentelem, salonga, ctrkprefix, rbxcpref ixed, itrkuri, parentid, newuri, desturi, netxp1, function, people, photos, fbhost, connect, overvie w, lights, directed, quotes, awards, credits, winners, category, episodes, search, movies, encodeuri component, images, reviews, trivia, remove, height, createelement, favorites, appendchild, metacriti c, special, 3cscript, facebook, unescape, static, featureloader, protocol, region, secure, 127953766 6 |
tv.com - rank der domain 1788 (716 in US)
|
| Arts/People/S/Salonga,_Lea |
| zum Seitenanfang ↑ |
| GameFAQs |
| Blasto FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/196777.html |
| Guide and PlayStation DexDrive save. |
| For Blasto on the PlayStation, GameFAQs has 2 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, blasto, iphone, container , nintendo, interactive, parentelem, gamespot, platforms, gamefaqs, itrkuri, content, newuri, beacon , techrepublic, college, parentid, genesis, saturn, dreamcast, arcade, password, metacritic, adverti se, search, gamecube, advance, ctrkprefix, rbxcprefixed, desturi, function, netxp1, digital, comtech republicthe, bargains, comshopper, insidertv, comurbanbaby, cbsnews, cbssports, sports, comuwirewall stripzdnet, phones, commysimonncaasearch, commoblogicmp3 |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Action-Adventure/B/Blasto |
| zum Seitenanfang ↑ |
| GameFAQs: Akella |
| Akella Company Information - GameFAQs |
| http://www.gamefaqs.com/features/company/43716.html |
| Links to pages for games developed by Akella. |
| Akella Company Information on GameFAQs, with a list of all games developed or published by Akella. |
| |
| imgelem, playstation, document, return, pirates, canceled, getelementbyid, itrkid, caribbean, classn ame, iphone, parentelem, metacritic, platforms, gamefaqs, island, interactive, nintendo, platform, j umper, renaissance, disciples, earthling, content, swashbucklers, college, function, saturn, netxp1, newuri, parentid, desturi, ctrkprefix, advance, gamecube, search, password, akella, company, arcade , genesis, dreamcast, itrkuri, rbxcprefixed, beacon, gamespot, advertise, sportscbs, fmmaxprepsmetac ritic, comcbsnews, radiocbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Developers_and_Publishers/A/Akella |
| zum Seitenanfang ↑ |
| GameFAQs: Evolution 2 |
| Evolution 2 FAQs, Walkthroughs, and Guides for Dreamcast - GameFAQs |
| http://www.gamefaqs.com/console/dreamcast/game/250583.html |
| A selection of walkthroughs and codes. |
| For Evolution 2 on the Dreamcast, GameFAQs has 6 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, evolution, itrkid, contai ner, dreamcast, gamespot, platforms, gamefaqs, nintendo, interactive, parentelem, metacritic, beacon , previews, itrkuri, college, advertise, content, search, advance, saturn, password, function, genes is, arcade, gamecube, netxp1, ctrkprefix, newuri, parentid, rbxcprefixed, desturi, bargains, sitebne tcbs, fmmaxprepsmetacritic, solutionsgamespotinternationallast, commoblogicmp3, commysimonncaasearch , comshopper, comchowcnetcnet, comcbssports, around, clearance, sportscbs, radiocbs |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/E/Evolution_Series |
| zum Seitenanfang ↑ |
| GameFAQs |
| Coded Arms Release Information for PSP - GameFAQs |
| http://www.gamefaqs.com/portable/psp/data/920834.html |
| Information and a message board. |
| For Coded Arms on the PSP, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, container, iphone, itrkid, parent elem, interactive, gamefaqs, metacritic, gamespot, platforms, nintendo, movies, adventure, advertise , college, content, beacon, previews, person, credits, submission, function, advance, ctrkprefix, it rkuri, parentid, netxp1, desturi, rbxcprefixed, search, saturn, newuri, gamecube, password, dreamcas t, genesis, arcade, forgot, commysimonncaasearch, insidertv, comurbanbaby, sitesselect, comtechrepub licthe, comshopper, commoblogicmp3, solutionsgamespotinternationallast |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/C/Coded_Arms |
| zum Seitenanfang ↑ |
| GameFAQs |
| Dungeon Lords Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/915110.html |
| Guides and discussion. |
| For Dungeon Lords on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, dungeo n, gamespot, parentelem, interactive, cbsiadglobal, gamefaqs, platforms, nintendo, playing, lordsdre amcatcher, content, college, arcade, dreamcast, gamecube, advance, search, metacritic, advertise, pr eviews, submission, designcharles, credits, password, action, desturi, saturn, beacon, itrkuri, pare ntid, genesis, newuri, rbxcprefixed, function, netxp1, ctrkprefix, window, overstock, clearance, hos ting, laptops, location |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/D/Dungeon_Lords |
| zum Seitenanfang ↑ |
| GameFAQs |
| Harvest Moon DS Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/925581.html |
| Contains information and a message board. |
| For Harvest Moon DS on the DS, the GameFAQs information page shows all known release data and credit s. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, container, harves t, gamefaqs, platforms, gamespot, interactive, metacritic, parentelem, nintendo, content, college, a dvertise, credits, breeding, colobocle, monogatari, strategy, beacon, function, saturn, desturi, rbx cprefixed, ctrkprefix, netxp1, gamecube, advance, search, password, arcade, dreamcast, genesis, subm ission, parentid, itrkuri, newuri, rankingsvisit, bargains, hosting, overstock, clearance, screensho ts, comcbssports, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/H/Harvest_Moon_Series/Harvest_Moon_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| Ape Escape: On the Loose Release Information for PSP - GameFAQs |
| http://www.gamefaqs.com/portable/psp/data/920778.html |
| Information and a message board. |
| For Ape Escape: On the Loose on the PSP, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, escape, classname, playstation, return, getelementbyid, iphone, gamespot, itrkid, container, gamefaqs, parentelem, platforms, interactive, nintendo, review, beacon, submission, 9860 903, advertise, college, action, credits, content, sceiucjs, previews, password, advance, ctrkprefix , search, rbxcprefixed, gamecube, function, netxp1, saturn, desturi, genesis, dreamcast, metacritic, arcade, itrkuri, parentid, newuri, comshopper, sitebnetcbs, comtechrepublicthe, comchowcnetcnet, co mcbssports, commysimonncaasearch, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Platform/Ape_Escape_Series/Ape_Escape_-_On_the_Loose |
| zum Seitenanfang ↑ |
| GameFAQs: Diablo II |
| Diablo II FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/197113.html |
| A large selection of walkthroughs and character guides. |
| For Diablo II on the PC, GameFAQs has 32 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, diablo, itrkid, container , parentelem, cbsiadglobal, gamespot, interactive, 01vincento1, nintendo, gamefaqs, platforms, genes is, netxp1, beacon, previews, editing, content, walkthrough09, guide12, guide08, walkthrough03, meta critic, search, advance, arcade, advertise, gamecube, dreamcast, function, itrkuri, parentid, destur i, rbxcprefixed, guide07, newuri, saturn, password, techrepublic, walkthrough07, college, ctrkprefix , gamerankings, sitemap, forums |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/D/Diablo_Series/Diablo_II/Cheats_and_Hints |
| zum Seitenanfang ↑ |
| GameFAQs |
| Lost in Blue Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/922241.html |
| Information and a message board. |
| For Lost in Blue on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, platfo rms, parentelem, gamespot, bluekonamintr, interactive, nintendo, gamefaqs, beacon, submission, konam i, credits, metacritic, college, advertise, itrkuri, saturn, function, advance, gamecube, arcade, dr eamcast, genesis, newuri, adventure, parentid, release, netxp1, desturi, search, ctrkprefix, rbxcpre fixed, person, password, content, overstock, clearance, hosting, sportscbs, comcbssports, comcbsnews , comchowcnetcnet, solutionsgamespotinternationallast |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Lost_in_Blue |
| zum Seitenanfang ↑ |
| GameFAQs |
| Gun Release Information for GameCube - GameFAQs |
| http://www.gamefaqs.com/console/gamecube/data/929181.html |
| Offers release data and a message board. |
| For Gun on the GameCube, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, gamecube, iphone, container, game spot, itrkid, parentelem, interactive, nintendo, platforms, gamefaqs, search, adventure, previews, b eacon, credits, advance, submission, action, review, metacritic, genesis, ctrkprefix, saturn, functi on, password, netxp1, rbxcprefixed, desturi, itrkuri, dreamcast, arcade, content, parentid, advertis e, newuri, college, comchowcnetcnet, comcbssports, commysimonncaasearch, comtechrepublicthe, insider tv, comurbanbaby, comuwirewallstripzdnet, comshopper, comcbsnews |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Shooter/G/Gun |
| zum Seitenanfang ↑ |
| GameFAQs |
| Egg Monster Hero Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/920764.html |
| Provides data, and a message board. |
| For Egg Monster Hero on the DS, the GameFAQs information page shows all known release data and credi ts. |
| |
| imgelem, document, classname, playstation, monster, return, getelementbyid, itrkid, iphone, containe r, interactive, gamespot, parentelem, nintendo, platforms, gamefaqs, beacon, search, action, advance , playing, previews, college, advertise, content, password, submission, genesis, dreamcast, arcade, desturi, rbxcprefixed, saturn, function, ctrkprefix, netxp1, herosquare, gamecube, newuri, credits, metacritic, parentid, itrkuri, solutionsgamespotinternationallast, sports, fmmaxprepsmetacritic, ins idertv, commoblogicmp3, commysimonncaasearch, comshopper, comurbanbaby |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Roleplaying/E/Egg_Monster_Hero |
| zum Seitenanfang ↑ |
| Blinded By Reality |
| GameSpot - /features/makeunreal/ |
| http://www.gamespot.com/features/makeunreal/ |
| GameSpot feature with screenshots by Geoffrey Keighley. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, schmalz, parentelem, gamespot, bleszinski, getelementbyid, develo pers, started, rockville, founder, sweeney, aficionados, action, called, designer, carpet, virtual, although, unreal, newuri, parentid, through, itrkuri, rbxcprefixed, ctrkprefix, function, netxp1, de sturi, megagames, housed, mainstream, working, decision, developer, fellow, apartment, development, dubbed, trying, polish, burned, studio, glamorous, latest, canadian, certainly, midnight, merely |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Shooter/U/Unreal_Games/Unreal |
| zum Seitenanfang ↑ |
| Meier, Sid - The Legacy |
| GameSpot - /features/sidlegacy/ |
| http://www.gamespot.com/features/sidlegacy/ |
| Gamespot article describing who he is and where he came from. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, parentelem, gamespot, getelementbyid, career, introduction, title s, industry, netxp1, parentid, itrkuri, himself, function, newuri, designers, ctrkprefix, rbxcprefix ed, desturi, selling, initial, commodore, market, intensive, pieces, graphics, pirates, museum, shel ves, tycoon, railroad, stands, reason, significance, historical, civilization, secret, everywhere, e nthusiasm, obscure, gamers, centauri, upcoming, crafting, passion, classics, especially, beginning, hidden |
gamespot.com - rank der domain 630 (263 in US)
|
| Games/Video_Games/Game_Design/Designers |
| zum Seitenanfang ↑ |
| GameFAQs |
| NHL 07 Release Information for Xbox 360 - GameFAQs |
| http://www.gamefaqs.com/console/xbox360/data/933705.html |
| FAQs, cheats, reviews, and a message board. |
| For NHL 07 on the Xbox 360, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, container, gamesp ot, interactive, parentelem, nintendo, sports, gamefaqs, platforms, sports09, credits, beacon, submi ssion, college, content, traditional, hockey, saturn, function, netxp1, advertise, genesis, search, password, metacritic, advance, gamecube, dreamcast, arcade, ctrkprefix, newuri, itrkuri, rbxcprefixe d, parentid, desturi, commysimonncaasearch, commoblogicmp3, phones, digital, cameras, fmmaxprepsmeta critic, movietome, comurbanbaby, comuwirewallstripzdnet |
gamefaqs.com - rank der domain 941 (399 in US)
|
| Games/Video_Games/Sports/Hockey/NHL_Games/NHL_Series/NHL_07 |
| zum Seitenanfang ↑ |
|
Sitemap.XML / Sitemap.HTML / search / Kontakt & Impressum / Domains
