| البيّنة |
| |
| http://www.albainah.net/ |
| الموسوعة السنيّة في الشيعة الإثني عشريّة. |
| |
| |
| document, getelementbyid, tempel, function, imgelem, return, iemarquee, offsetparent, calenderid, tx tsearchword, docjslib, anothercalenderid, script, display, parseint, offsettop, offsetleft, scrollma rquee, copyspeed, window, showcalender, validate, setinterval, offsetwidth, getrealleft, javascript, location, protocol, setaccount, 17523802, trackpageview, createelement, validatesearch, getrealtop, pausespeed, insertbefore, parentnode, analytics, google, getelementsbytagname, marqueespeed |
albainah.net - rank der domain 941355 (2187 in SA)
|
| World/Arabic/مجتمع/أديان_و_معتقدات/وجهات_نظر_معارضة/إسلام/شيعة |
| zum Seitenanfang ↑ |
| البيّنة |
| |
| http://www.albainah.net/ |
| الموسوعة السنيّة في الشيعة الإثني عشريّة. |
| |
| |
| document, getelementbyid, tempel, function, imgelem, return, iemarquee, offsetparent, calenderid, tx tsearchword, docjslib, anothercalenderid, script, display, parseint, offsettop, offsetleft, scrollma rquee, copyspeed, window, showcalender, validate, setinterval, offsetwidth, getrealleft, javascript, location, protocol, setaccount, 17523802, trackpageview, createelement, validatesearch, getrealtop, pausespeed, insertbefore, parentnode, analytics, google, getelementsbytagname, marqueespeed |
albainah.net - rank der domain 941355 (2187 in SA)
|
| World/Arabic/إقليمـي/الشرق_الأوسط/السعودية/مجتمع/إسلام/مذاهب_و_فرق |
| zum Seitenanfang ↑ |
| imgelem |
|
|
| imgelem |
| zum Seitenanfang ↑ |
| CNET TV |
|
| http://www.cnettv.com |
| Video broadcasts of technology news, product information and ways to get the most out of your tech. |
| |
| |
| iphone, notebooks, imgelem, cnettv, function, todaysplaylist, looking, return, display, ctvvalue, ad dparam, ctvname, document, laptop, macbook, ctvtype, isparent, phones, lenovo, netbook, android, img alt, imgpath, samsung, series, window, itrkid, popular, player, userbucket, qvalue, addevent, domrea dy, reasons, pagetype, twitter, interactive, compact, getelementbyid, sprint, google, tekzilla, heig ht, parentelem, screensaver, intercept, ericsson, smartphones, podcast, episode, xperia |
| (SLD : cnettv.com) |
| News/Internet_Broadcasts |
| zum Seitenanfang ↑ |
| First Presbyterian Church, Morris, Illinois |
| First Presbyterian Church, Morris |
| http://firstpresmorris.org/ |
| Contact information and directions. |
| |
| |
| document, tempel, visibility, function, imgelem, divobj2, myarray, getelementbyid, divarray, return, gcount, length, divobj, netscape, explorer, menudiv, hidden, presbyterian, positionx, positiony, la yers, offsetparent, getrealtop, joseph, getrealleft, church, prepdhtmlmenu1, through, visible, frida y, events, presbyts, morris, window, service, religous, zindex, offsetleft, offsettop, prepdhtmlmenu 2, information, calendar, edstronghold, inyouthsenior, presbytsmpwchristian, church, office, communi typresbyts, highjunior, homechurch, calendardirectionslog |
| (SLD : firstpresmorris.org) |
| Society/Religion_and_Spirituality/Christianity/Denominations/Presbyterian/Presbyterian_Church_USA/Churches/United_States/Illinois |
| zum Seitenanfang ↑ |
| imgelem |
|
|
| imgelem |
| zum Seitenanfang ↑ |
| Urban Baby |
|
| http://urbanbaby.com/ |
| A network of resource guides, interactive communities and an online store for urban parents in the t op metropolitan cities of the world. |
| |
| |
| imgelem, general, topics, document, return, urbanbaby, itrkid, getelementbyid, parentelem, pagetrack er, anyone, parties, disney, advertise, things, because, whipped, policy, change, interactive, ctrkp refix, gajshost, parentid, function, itrkuri, netxp1, working, career, rbxcprefixed, children, destu ri, techrepublic, newuri, francisco, parents, granddaughter, results, previous, cooking, olivia, gra ndma, recipes, school, lunchbox, cookies, script, minors, obsessive, serving, guests, casserole |
urbanbaby.com - rank der domain 59202 (22439 in US)
|
| Home/Family/Babies |
| zum Seitenanfang ↑ |
| GameFAQs Reviews |
| Chron X Reviews for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/review/196915.html |
| A compilation of reviews by users. |
| For Chron X on the PC, GameFAQs has 4 reviews. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, iphone, container, gamesp ot, interactive, gamefaqs, nintendo, parentelem, platforms, beacon, content, college, review, saturn , function, genesis, password, metacritic, reviews, search, advance, dreamcast, arcade, gamecube, ad vertise, ctrkprefix, parentid, rbxcprefixed, desturi, itrkuri, newuri, netxp1, comtechrepublicthe, f mmaxprepsmetacritic, comshopper, digital, commoblogicmp3, commysimonncaasearch, phones, sports, cbsn ews, players, sitemap, comurbanbaby, comuwirewallstripzdnet |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Strategy/Turn-Based/Chron_X/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot |
| E3 2001 Hands-OnSimsVille - PC Previews at GameSpot |
| http://www.gamespot.com/pc/strategy/simsville/preview_2762367.html |
| Includes a preview of the game as seen at E3, and screen shots. |
| This new game combines elements of The Sims with SimCity. |
| |
| imgelem, document, simsville, gamespot, function, buildings, return, stations, getelementbyid, scrip t, previews, structures, skills, images, itrkid, parentelem, andreas, onsimsville, simcity, business , interactive, connect, different, location, facebook, scroll, across, entertainment, rbxcprefixed, stories, netxp1, actually, cbsinteractive, sports, cbsnews, cbssports, shopping, public, appendchild , ctrkprefix, police, typical, beacon, friends, current, really, within, construct, information, cur rently, newuri |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Simulation/God_Games/Sim_Games/SimsVille/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| Chowhound |
| Austin - Chowhound |
| http://chowhound.chow.com/boards/61 |
| Forum where you can ask questions and get answers about dining in Austin. |
| Tips for Dining, Eating, and Food Shopping in Austin, TX |
| |
| austin, imgelem, document, general, recipe, scrumptiouschef, amysuehere, topics, angeles, greater, c ooking, return, boston, archive, chowhound, getelementbyid, chowhounding, luckyfatima, autocomplete, recipes, francisco, itrkid, southwest, posted, including, dishes, breakfast, england, newsletters, stories, parentelem, interactive, atlantic, brunch, southern, manhattan, dinner, gateway, function, addlepated, chispa, ontario, toronto, thorkel, topics, addtoloc, myysharona, pagetracker, password, sidebar, canada |
chow.com - rank der domain 3644 (1387 in US)
|
| Regional/North_America/United_States/Texas/Localities/A/Austin/Business_and_Economy/Restaurants_and_Bars/Guides_and_Directories |
| zum Seitenanfang ↑ |
| The Bible Condensed |
| The Bible Condensed |
| http://www.thebiblecondensed.com/ |
| Excerpts from Genesis to Revelation in 365 daily readings with commentary. |
| The Bible Condensed. From Gene |
| bible, scripture, reading, pla |
| samuel, chronicles, genesis, corinthians, exodus, document, psalms, matthew, isaiah, revelation, deu teronomy, tempel, timothy, jeremiah, function, leviticus, numbers, visibility, romans, divarray, img elem, myarray, divobj2, getelementbyid, joshua, gcount, return, hebrews, kingdom, length, sermon, ju dges, explorer, nehemiah, divobj, netscape, thessalonians, proverbs, menudiv, ephesians, hungry, zec hariah, hilltop, positiony, esther, positionx, ezekiel, layers, daniel, prayer, forgive |
| (SLD : thebiblecondensed.com) |
| Society/Religion_and_Spirituality/Christianity/Bible/Reading_Plans |
| zum Seitenanfang ↑ |
| Jericho Road Baptist Church |
|
| http://www.jrbc-lmcs.org/ |
| Service schedule, statement of faith, directions, and information on La Mesa Christian School. |
| |
| |
| document, tempel, visibility, function, myarray, getelementbyid, divarray, imgelem, divobj2, gcount, return, length, netscape, divobj, explorer, menudiv, sunday, school, positiony, positionx, christia n, offsetparent, website, calendar, layers, hidden, events, prepdhtmlmenu1, getrealtop, getrealleft, sports, baptist, jericho, visible, window, service, directions, offers, prepdhtmlmenu2, tuition, ch urch, number, reminders, offsetleft, ministries, church, offsettop, zindex, school, hidemenu, settim eout |
| (SLD : jrbc-lmcs.org) |
| Regional/North_America/United_States/California/Localities/L/La_Mesa/Society_and_Culture/Religion |
| zum Seitenanfang ↑ |
| GameSpot |
| The Sims: Hot Date Preview - PC Previews at GameSpot |
| http://www.gamespot.com/pc/strategy/simshotdateexpansionpack/preview_2805061.html |
| Preview with detailed description of gameplay, screenshots, and concept sketches. |
| We've got the scoop on the next add-on for The Sims straight from Maxis. |
| |
| imgelem, document, gamespot, function, downtown, return, previews, script, getelementbyid, location, itrkid, cheats, reviews, images, andreas, connect, facebook, parentelem, score8, player, preview, i nteractive, cbssports, articles, expansion, cbsnews, components, meaning, designers, always, college , considering, sports, cbsinteractive, videos, features, answers, summary, comment, universe, 280506 1, stories, someone, looked, social, original, creating, restaurants, different, titles, content |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Simulation/God_Games/Sim_Games/The_Sims_Series/The_Sims/Hot_Date |
| zum Seitenanfang ↑ |
| Terror Labs |
| Terror Labs - Welcome |
| http://www.terrorlabs.com |
| Features lab items, body parts, skeletons, masks, environmental effects, lighting, edibles, and deco r. |
| |
| halloween,skeletons,skulls,skeleton,skull,gore,horror,scare,fright |
| tempel, document, getelementbyid, imgelem, function, divcart, offsetparent, return, browser, cartspa ce, intitem, display, terror, offsettop, gettop, offsetleft, getmousexy, getleft, season, scream, ar ound, please, 2checkout, provided, services, urchintracker, 1437449, retailer, delivery, halloween, authorized, guarantee, projects, domouseon, domouseoff, scrollleft, clientx, clienty, scrolltop, his tory, novelties, contact, welcome, skeletons, edibles, startiefix |
| (SLD : terrorlabs.com) |
| Shopping/Holidays/Halloween |
| zum Seitenanfang ↑ |
| GameFAQs: Wizardry |
| Wizardry FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/564837.html |
| FAQ and walkthrough. |
| For Wizardry on the PC, GameFAQs has 1 FAQ (game guide/walkthrough). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, ninten do, gamespot, interactive, parentelem, gamefaqs, platforms, college, content, parentid, itrkuri, bea con, metacritic, newuri, genesis, advance, dreamcast, gamecube, search, password, arcade, ctrkprefix , netxp1, advertise, function, rbxcprefixed, desturi, saturn, maxpreps, sports, overstock, internati onal, cbssports, speakers, solutions, cbsnews, hosting, fmmaxprepsmetacritic, sitesselect, sitebnetc bs, sportscbs, radiocbs, moblogic |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/W/Wizardry_Series/Wizardry_I_-_Proving_Grounds_of_the_Mad_Overlord |
| zum Seitenanfang ↑ |
| CNET.com: Simply RSS |
| RSS Feeds | Home - CNET.com |
| http://www.cnet.com/4520-6022-5115113.html |
| Directory of feeds from CNET.com, ZDNet, download.com, TechRepublic, builder.com, GameSpot, and Webs hot. |
| |
| |
| imgelem, document, windows, networks, return, getelementbyid, sidedoor, itrkid, products, function, height, require, parentelem, reserves, display, popular, interactive, content, readers, reviews, inf ormation, notebooks, downloads, newuri, version, 5115113, graphic, getelement, address, localvars, s hopper, popular, directory, available, innerhtml, windowheight, uservars, ctrkprefix, netxp1, distri buting, pagevars, itrkuri, parentid, desturi, specification, rbxcprefixed, topics, phones, product, mobile, attribution |
cnet.com - rank der domain 100 (49 in US)
|
| Computers/Internet/On_the_Web/Syndication_and_Feeds/RSS/Directories |
| zum Seitenanfang ↑ |
| Gonzales Baptist Temple |
| Gonzales Baptist Temple |
| http://www.gonzalesbaptisttemple.org/ |
| Includes schedule, events calendar, directions, ministries, sermons, prayer requests, and newsletter s. |
| |
| |
| document, tempel, visibility, function, divobj2, getelementbyid, imgelem, divarray, myarray, gcount, length, return, netscape, explorer, divobj, baptist, menudiv, gonzales, layers, christian, temple, offsetparent, hidden, positionx, positiony, prepdhtmlmenu1, events, visible, getrealtop, sermons, ge trealleft, sermonsaudio, offsetleft, bluegrass, zindex, wednesdays, offsettop, southern, outlines, j anuary, window, february, distributi, rejoice, college, rogers, needed, photos, prepdhtmlmenu2, cale ndar, sundays |
| (SLD : gonzalesbaptisttemple.org) |
| Regional/North_America/United_States/Louisiana/Localities/B/Brittany |
| zum Seitenanfang ↑ |
| GameFAQs - Codes and Secrets - Slayer |
| Slayer Cheats, Codes, and Secrets for 3DO - GameFAQs |
| http://www.gamefaqs.com/console/3do/code/917943.html |
| Collection of known cheats. |
| For Slayer on the 3DO, GameFAQs has 1 cheat. |
| |
| imgelem, document, classname, getelementbyid, playstation, message, return, itrkid, iphone, containe r, gamefaqs, function, parentelem, metacritic, platforms, interactive, nintendo, gamespot, beacon, s ubmission, advertise, content, college, password, desturi, rbxcprefixed, arcade, gamecube, ctrkprefi x, netxp1, advance, search, dreamcast, newuri, cheats, parentid, genesis, itrkuri, saturn, radiocbs, comshopper, solutionsgamespotinternationallast, sportscbs, fmmaxprepsmetacritic, commysimonncaasear ch, comtechrepublicthe, commoblogicmp3, insidertv, comcbsnews, comurbanbaby, comchowcnetcnet |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/Rogue-like/Slayer |
| zum Seitenanfang ↑ |
| GameSpot |
| ASC Games To Shut Down - News at GameSpot |
| http://www.gamespot.com/news/2000/01/06/news_2446015.html |
| Article on the closure of ASC Games. |
| Werewolf: The Apocalypse developer and publisher to close its doors this Friday. |
| |
| imgelem, gamespot, document, posted, function, return, comments, script, stories, company, facebook, itrkid, getelementbyid, sports, connect, interactive, andreas, studio, showcase, location, faction, metacritic, parentelem, mysimon, 2fnews, gamespot, moneywatch, connect, fbinit, window, 2446015, ma xpreps, movietome, smartplanet, titles, insider, techrepublic, official, search, shopper, informatio n, beacon, showtime, capcom, online, cbsnews, cbssports, cbsinteractive, college, cheats, cheatsgta |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Roleplaying/World_of_Darkness_Games/Werewolf_-_The_Apocalypse |
| zum Seitenanfang ↑ |
| Theatre Development Fund |
| TDF - Theatre Development Fund |
| http://www.tdf.org/ |
| Non-profit service organization for the performing arts. Discount ticket sales, marketing strategies , novice producer training programs. |
| |
| |
| dhtmlgoodies, addsubmenuitem, servicepage, document, tooltip, getelementbyid, tooltipshadow, functio n, tempel, return, browser, checkit, imgelem, display, leftpos, rotate, indexof, shadowsize, targetx , offsetparent, navigator, useragent, border, targety, getbrowser, target, addsubmenu, bodywidth, if rame, string, tooltipmaxwidth, visibility, duration, theatre, tooltipwidth, nodetohide, nodetoshow, styleunchoose, fadeduration, visible, rotateduration, stylechosen, imgsrc, accessibility, appendchil d, firefox, getimageyfromtop, offsetleft, tolowercase, scrolltop, thestring |
tdf.org - rank der domain 118174 (45596 in US)
|
| Arts/Performing_Arts/Theatre/Organizations |
| zum Seitenanfang ↑ |
| GameSpot |
| Ghost Recon: Desert Siege Preview - PC Previews at GameSpot |
| http://www.gamespot.com/pc/action/tomclancysghostreconds/preview_2855128.html |
| Preview and screen shots. |
| We take a look at the forthcoming expansion pack to Ghost Recon. |
| |
| clancy, imgelem, document, gamespot, function, return, desert, splinter, script, mission, getelement byid, previews, cheats, images, reviews, rainbow, itrkid, destroy, against, parentelem, mature, cont ent, connect, missions, preview, interactive, another, facebook, location, score8, andreas, governme nt, articles, sports, college, cbssports, hiding, titles, nation, hostages, cbsinteractive, future, soldier, cbsnews, ethiopian, trucks, player, universe, starcraft, looked, because |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Shooter/T/Tom_Clancy_Games/Ghost_Recon_Series/Ghost_Recon/Desert_Siege/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs: Avernum 4 |
| Avernum 4 Cheats, Codes, and Secrets for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/code/932021.html |
| Contains cheats for Avernum 4. |
| For Avernum 4 on the PC, GameFAQs has 11 cheat codes and secrets. |
| |
| document, imgelem, classname, playstation, getelementbyid, message, return, gamespot, iphone, avernu m, itrkid, container, parentelem, gamefaqs, interactive, platforms, function, nintendo, content, cri mes, college, advertise, character, metacritic, making, desturi, newuri, genesis, itrkuri, rbxcprefi xed, ctrkprefix, saturn, netxp1, parentid, search, advance, gamecube, submission, cheats, password, beacon, arcade, dreamcast, working, hosting, speakers, clearance, sitesselect, bargains, sitebnetcbs , overstock |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/A/Avernum_Series |
| zum Seitenanfang ↑ |
| Gonzales Baptist Temple |
| Gonzales Baptist Temple |
| http://www.gonzalesbaptisttemple.org/ |
| Includes schedule, events calendar, directions, ministries, sermons, prayer requests, and newsletter s. Brittany. |
| |
| |
| document, tempel, visibility, function, getelementbyid, divobj2, imgelem, divarray, myarray, return, gcount, length, explorer, divobj, netscape, baptist, gonzales, menudiv, christian, temple, layers, offsetparent, hidden, positionx, positiony, events, prepdhtmlmenu1, getrealtop, visible, sermons, ge trealleft, offsetleft, bluegrass, southern, sermonsaudio, wednesdays, offsettop, zindex, rogers, out lines, window, february, january, distributi, rejoice, college, prepdhtmlmenu2, needed, photos, cale ndar, sundays |
| (SLD : gonzalesbaptisttemple.org) |
| Society/Religion_and_Spirituality/Christianity/Denominations/Baptist/Baptist_Groups/Independent_Baptists/Local_Churches/United_States/Louisiana |
| zum Seitenanfang ↑ |
| GameSpot - The Greatest Games of All Time |
| The Greatest Games of All Time |
| http://www.gamespot.com/gamespot/features/all/greatestgames/ |
| Bi-weekly feature of games that have been uniquely influential and defined their genre. |
| The Greatest Games of All Time |
| Marble Madness, |
| imgelem, gamespot, document, arcade, function, greatest, return, script, itrkid, gamespot, backgroun d, fighter, better, tentacle, because, playing, metacritic, fantasy, parentelem, connect, getelement byid, different, facebook, andreas, location, interactive, genesis, system, legend, articles, moneyw atch, maxpreps, cbssports, cbsnews, college, cbsinteractive, sports, movietome, window, fbinit, conn ect, beacon, urbanbaby, search, mysimon, shopper, showtime, insider, techrepublic, smartplanet, chea tsgta |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/News_and_Reviews/Awards |
| zum Seitenanfang ↑ |
| Theatre Development Fund |
| TDF - Theatre Development Fund |
| http://www.tdf.org/ |
| Non-profit service organization for the performing arts. Discout ticket sales, marketing strategies, novice producer training programs. |
| |
| |
| dhtmlgoodies, addsubmenuitem, servicepage, document, tooltip, getelementbyid, tooltipshadow, functio n, tempel, return, browser, checkit, display, imgelem, rotate, leftpos, shadowsize, navigator, borde r, useragent, indexof, offsetparent, targetx, targety, bodywidth, tooltipmaxwidth, visibility, ifram e, addsubmenu, string, tooltipwidth, duration, getbrowser, theatre, target, stylechosen, styleunchoo se, visible, rotateduration, nodetoshow, fadeduration, nodetohide, getrealleft, accessibility, nodet oshow, thestring, vouchers, detect, offsetleft, tooltiptxt, offsettop |
tdf.org - rank der domain 118174 (45596 in US)
|
| Regional/North_America/United_States/New_York/Localities/N/New_York_City/Manhattan/Arts_and_Entertainment/Theater |
| zum Seitenanfang ↑ |
| GameFAQs: Arc the Lad |
| Arc the Lad FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/572644.html |
| Walkthroughs and FAQs. |
| For Arc the Lad on the PlayStation, GameFAQs has 10 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, gamespot, itrk id, interactive, parentelem, gamefaqs, platforms, nintendo, walkthrough05, gamecube, beacon, hacking , password, college, metacritic, search, content, advance, netxp1, rbxcprefixed, desturi, genesis, s aturn, ctrkprefix, itrkuri, parentid, dreamcast, arcade, function, newuri, advertise, comchowcnetcne t, forums, comcbssports, commysimonncaasearch, comurbanbaby, insidertv, comuwirewallstripzdnet, comc bsnews, sports, comtechrepublicthe, fmmaxprepsmetacritic, solutionsgamespotinternationallast, commob logicmp3 |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad |
| zum Seitenanfang ↑ |
| GameFAQs: Torneko: The Last Hope |
| Torneko: The Last Hope Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/374986.html |
| Reader reviews. |
| For Torneko: The Last Hope on the PlayStation, GameFAQs has 8 reviews. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, torneko, container, itrki d, gamespot, gamefaqs, interactive, platforms, parentelem, nintendo, advertise, techrepublic, metacr itic, 10gamefaqs, college, content, review, password, beacon, saturn, function, reviews, ctrkprefix, netxp1, arcade, gamecube, advance, search, dreamcast, genesis, rbxcprefixed, desturi, newuri, itrku ri, parentid, around, sitebnetcbs, previews, sportscbs, sitesselect, rankingsvisit, solutionsgamespo tinternationallast, fmmaxprepsmetacritic, movies, gameplay |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/D/Dragon_Warrior_Series/Torneko_-_The_Last_Hope/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs |
| Dragon Warrior VII Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/197152.html |
| Reader reviews and a preview. |
| For Dragon Warrior VII on the PlayStation, GameFAQs has 42 reviews. |
| |
| imgelem, document, warrior, playstation, classname, return, getelementbyid, dragon, itrkid, containe r, gamespot, 10dragon, iphone, parentelem, school, platforms, gamefaqs, nintendo, interactive, revie w, previews, metacritic, advertise, beacon, content, college, 10gamefaqs, finally, gameplay, simply, amazing, newuri, parentid, rbxcprefixed, ctrkprefix, password, itrkuri, search, dreamcast, genesis, arcade, gamecube, advance, netxp1, desturi, saturn, reviews, function, gamer6, including, resources gamespotvisit |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/D/Dragon_Warrior_Series/Dragon_Quest_VII/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot: Best of E3 2000 |
| MechWarrior 4 - PC Previews at GameSpot |
| http://www.gamespot.com/pc/sim/mechwarrior4vengeance/preview_2569050.html |
| Impressions of the game at E3 2000. |
| The latest build of MechWarrior 4 boasts updated graphics and complete Mech models. |
| |
| mechwarrior, imgelem, document, gamespot, function, return, previews, script, getelementbyid, cheats , images, microsoft, itrkid, looked, location, reviews, combat, connect, facebook, interactive, andr eas, features, impressive, score8, mercenaries, parentelem, studio, college, sports, cbsinteractive, search, shopper, mysimon, createelement, cbssports, engine, metacritic, maxpreps, ground, articles, moneywatch, movietome, summary, cbsnews, itrkuri, review, showcase, series, development, faction, m echwarrior |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Shooter/Mecha_Combat_Simulation/MechWarrior_Series/MechWarrior_4_-_Vengeance/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot |
| MechWarrior 3 Review for PC - GameSpot |
| http://www.gamespot.com/pc/sim/mechwarrior3/review.html |
| Review by Greg Kasavin, scoring 8.3/10: "MechWarrior 3 looks, sounds, and controls better than anyth ing else like it." |
| It might seem rough around the edges once in a while, but nevertheless, MechWarrior 3 is a worthy su ccessor to one of the best games of the decade. |
| MechWarrior 3 Review for PC, PC MechWarrior 3 Review, MechWarrior 3 Review, PC MechWarrior 3, MechWa rrior 3 for PC, MechWarrior 3 Article, MechWarrior 3 Hands On |
| mechwarrior, imgelem, gamespot, document, function, return, weapons, reviews, review, machine, scrip t, interactive, getelementbyid, around, powerful, cheats, missions, player, especially, everything, little, itrkid, simulation, combat, exciting, score8, andreas, combat, graphics, important, facebook , connect, campaign, cbsiadglobal, easily, action, location, predecessor, anything, attack, parentel em, because, pilots, opponents, number, battles, surrounding, enemies, against, similarly, itrkuri |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Shooter/Mecha_Combat_Simulation/MechWarrior_Series/MechWarrior_3/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot |
| F/A-18 Review for PC - GameSpot |
| http://www.gamespot.com/pc/sim/fa18/review.html |
| Review by Bruce Geryk, [8.8/10]. "Jane's F/A-18 will hook you soon enough, and once it does there's no turning back." |
| Jane's F/A-18 succeeds in being a superb flight simulator without being truly exceptional in any spe cific area. |
| F/A-18 Review for PC, PC F/A-18 Review, F/A-18 Review, PC F/A-18, F/A-18 for PC, F/A-18 Article, F/A -18 Hands On |
| document, imgelem, flight, gamespot, graphics, function, campaign, return, simulation, review, getel ementbyid, detail, elements, script, because, without, specific, aircraft, carrier, itrkid, parentel em, manual, metacritic, bolter, facebook, reviews, though, gamers, connect, score8, andreas, simulat ions, terrain, functions, cockpit, missions, accurately, content, location, interactive, scripted, v ariable, around, cbsinteractive, sports, flanker, college, different, novice, drivers, scores |
gamespot.com - rank der domain 618 (258 in US)
|
|
| zum Seitenanfang ↑ |
| GameSpot's Guide |
| GameSpot - /features/baldurs_gg/ |
| http://www.gamespot.com/features/baldurs_gg/ |
| Walkthrough. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, contains, document, quests, itrkid, character, parentelem, locations, baldur, chara cters, monsters, comprehensive, enemies, gamespot, through, getelementbyid, deadly, detailed, availa ble, player, numerous, desturi, rbxcprefixed, ctrkprefix, itrkuri, parentid, newuri, netxp1, functio n, respective, showcase, manage, attributes, unsure, encounters, abilities, interesting, creation, p retty, development, important, description, actually, tavern, eleventh, corner, review, sheepish, lo oking, hanging |
gamespot.com - rank der domain 618 (258 in US)
|
|
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/awards1998/ |
| http://www.gamespot.com/features/awards1998/ |
| Picks for the best and worst of 1998. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, gamespot, document, itrkid, parentelem, released, getelementbyid, function, obsessi on, netxp1, gaming, genres, difficult, ctrkprefix, marked, desturi, parentid, itrkuri, newuri, strat egy, rbxcprefixed, diversity, recent, balanced, between, gracefully, memory, almost, simulations, pa ckaging, choosing, content, better, themselves, concerned, harder, special, awards, achievement, pro cess, excited, future, subsided, seemed, ignored, heralded, hybrids, action, playing, shooters |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/News_and_Reviews/Awards/1998 |
| zum Seitenanfang ↑ |
| GameFAQs |
| F.E.A.R. Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/920744.html |
| Release data and a message board. |
| For F.E.A.R. on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, software, getelementbyid, itrkid, iphone, contain er, gamespot, parentelem, interactive, platforms, capture, games10, nintendo, gamefaqs, credits, pre views, director, college, content, advertise, metacritic, person, shooter, action, review, submissio n, arcade, netxp1, gamecube, advance, itrkuri, parentid, dreamcast, desturi, genesis, newuri, ctrkpr efix, rbxcprefixed, beacon, saturn, password, release, function, search, rankingsvisit, rankings, ga meplay |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Shooter/F/F.E.A.R. |
| zum Seitenanfang ↑ |
| GameFAQs |
| Robots Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/924608.html |
| Information and a message board. |
| For Robots on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, gamesntr, container, ipho ne, additional, robots, parentelem, gamefaqs, metacritic, platforms, interactive, nintendo, gamespot , submission, design, credits, advertise, arbp03, content, college, beacon, adventure, action, netxp 1, arcade, dreamcast, ctrkprefix, desturi, advance, parentid, newuri, gamecube, saturn, genesis, fun ction, itrkuri, rbxcprefixed, search, password, players, something, gamerankings, movietome, sitemap , phones |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action-Adventure/R/Robots |
| zum Seitenanfang ↑ |
| GameFAQs |
| Hellfire FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/47583.html |
| A selection of walkthroughs. |
| For Hellfire on the PC, GameFAQs has 4 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, gamespot, container, ipho ne, hellfire, gamefaqs, nintendo, interactive, platforms, parentelem, itrkuri, college, content, bea con, advertise, metacritic, parentid, saturn, password, search, genesis, netxp1, function, arcade, d esturi, gamecube, advance, newuri, rbxcprefixed, dreamcast, ctrkprefix, comurbanbaby, insidertv, spe akers, comtechrepublicthe, forgot, commysimonncaasearch, comshopper, players, hosting, comuwirewalls tripzdnet, solutions, international, cbssports, commoblogicmp3 |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/D/Diablo_Series/Diablo/Hellfire |
| zum Seitenanfang ↑ |
| GameFAQs |
| Pac-Pix Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/920755.html |
| Data, FAQs, reviews, and a message board. |
| For Pac-Pix on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, pixnamcontr, interactive, parentelem, platforms, nintendo, gamefaqs, gamecube, metacritic, submi ssion, advance, advertise, search, function, college, content, password, miscellaneous, arcade, cred its, previews, desturi, beacon, newuri, genesis, itrkuri, parentid, netxp1, ctrkprefix, saturn, rbxc prefixed, dreamcast, hosting, clearance, overstock, speakers, phones, digital, cameras, laptops, ran kingsvisit, bargains |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/P/Pac-Man_Games/Pac-Pix |
| zum Seitenanfang ↑ |
| GameFAQs: Master of Magic |
| Master of Magic FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/564960.html |
| An FAQ. |
| For Master of Magic on the PC, GameFAQs has 1 FAQ (game guide/walkthrough). |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, iphone, container, gamesp ot, nintendo, interactive, parentelem, gamefaqs, platforms, newuri, itrkuri, college, beacon, conten t, parentid, metacritic, advertise, dreamcast, search, advance, gamecube, genesis, saturn, function, netxp1, ctrkprefix, rbxcprefixed, desturi, password, arcade, sports, cbsnews, cbssports, internatio nal, moblogic, mysimon, shopper, maxpreps, solutions, comuwirewallstripzdnet, commoblogicmp3, guides , sitesselect, sitebnetcbs, bargains |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Strategy/Turn-Based/Master_of_Magic |
| zum Seitenanfang ↑ |
| GameFAQs: Arc the Lad II |
| Arc the Lad II FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/572645.html |
| Provides numerous walkthroughs and faqs. |
| For Arc the Lad II on the PlayStation, GameFAQs has 19 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, ninten do, gamespot, interactive, gamefaqs, platforms, parentelem, metacritic, beacon, college, content, wa lkthrough06, advertise, saturn, function, ctrkprefix, netxp1, gamecube, advance, search, password, a rcade, genesis, dreamcast, rbxcprefixed, itrkuri, newuri, parentid, desturi, bargains, solutionsgame spotinternationallast, overstock, speakers, hosting, rankingsvisit, clearance, comcbsnews, radiocbs, comcbssports, comchowcnetcnet, sportscbs, sitesselect, sitebnetcbs |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad_II |
| zum Seitenanfang ↑ |
| TV.com: Christopher Khayman Lee |
| Christopher Khayman Lee on TV.com |
| http://www.tv.com/christopher-khayman-lee/person/18209/summary.html |
| Filmography and biographical information. |
| |
| Christopher Khayman Lee, , photos, videos, life, biography, career, credits |
| imgelem, document, return, itrkid, videos, getelementbyid, background, khayman, parentelem, christop her, ctrkprefix, rbxcprefixed, parentid, newuri, desturi, features, itrkuri, function, height, heade r, photos, people, position, netxp1, adinfo, fbhost, connect, quotes, awards, category, trivia, epis odes, winners, nominations, reviews, remove, favorites, dispatches, writers, search, credits, append child, domino, createelement, features, encodeuricomponent, overview, images, lights, sucked, admitt ed |
tv.com - rank der domain 1765 (712 in US)
|
| Arts/People/L/Lee,_Christopher_Khayman |
| zum Seitenanfang ↑ |
| Microsoft Plans Toilets With Web Access |
|
| http://news.cnet.com/2100-1041_3-999509.html |
| Article reporting that Microsoft is developing public toilets with Internet access. [Contains fictit ious information] |
| |
| |
| microsoft, imgelem, portable, comment, display, internet, iphone, access, return, dropdown, comments , whittingham, siteid, toilet, document, function, jlogger, rental, pagevars, recent, address, eleme nt, plasma, popular, security, wireless, 999509, itrkid, headlines, cancel, summer, keyboard, market , portable, hotmail, content, report, height, another, posting, personal, offensive, software, inter active, festival, windows, subscribers, comment, parentelem, posted, direct |
cnet.com - rank der domain 100 (49 in US)
|
| Reference/Education/Instructional_Technology/Evaluation/Web_Site_Evaluation/Hoax_Sites |
| zum Seitenanfang ↑ |
| Engine Settings FAQ |
| F-Zero X FAQs, Walkthroughs, and Guides for Nintendo 64 - GameFAQs |
| http://www.gamefaqs.com/console/n64/game/197414.html |
| Walkthrough and FAQs. |
| For F-Zero X on the Nintendo 64, GameFAQs has 10 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, classname, playstation, return, nintendo, getelementbyid, itrkid, container, ipho ne, interactive, platforms, gamespot, parentelem, gamefaqs, beacon, itrkuri, advertise, college, met acritic, content, saturn, password, function, netxp1, dreamcast, arcade, gamecube, advance, genesis, search, ctrkprefix, rbxcprefixed, desturi, parentid, newuri, bargains, comshopper, clearance, hosti ng, comtechrepublicthe, overstock, sitesselect, sitebnetcbs, commoblogicmp3, commysimonncaasearch, c omchowcnetcnet, solutionsgamespotinternationallast, comcbssports, comcbsnews, speakers |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Driving_and_Racing/Racing/F-Zero_Series/F-Zero_X |
| zum Seitenanfang ↑ |
| First Impression: The Sims Online |
| First ImpressionThe Sims Online - PC Previews at GameSpot |
| http://www.gamespot.com/pc/rpg/simsonline/preview_2762518.html |
| Preview from Gamespot on game. Reveals more on gameplay and also comments on graphics and difference s from The Sims. |
| Find out what you can expect from the new online game based on The Sims. |
| |
| online, imgelem, document, gamespot, function, players, return, script, previews, getelementbyid, be come, online, cheats, itrkid, reviews, images, personality, within, entire, interactive, features, p arentelem, different, player, richest, impressionthe, andreas, office, device, operate, facebook, lo cation, connect, faction, famous, friends, 360wiips3ps2pspdsiphonemobileforumsvideoscheatsnew, score 6, configure, captain, eggplant, comment, possible, interaction, course, various, titles, window, 27 62518, hearts, portion |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Simulation/God_Games/Sim_Games/The_Sims_Series/The_Sims_Online |
| zum Seitenanfang ↑ |
| TV.com: Brooke Nevin |
| Brooke Nevin on TV.com |
| http://www.tv.com/brooke-nevin/person/68940/summary.html |
| Filmography and biographical information. |
| |
| Brooke Nevin, , photos, videos, life, biography, career, credits |
| imgelem, document, return, itrkid, videos, getelementbyid, brooke, background, parentelem, netxp1, c trkprefix, features, rbxcprefixed, newuri, adinfo, height, people, photos, header, position, functio n, desturi, connect, fbhost, itrkuri, parentid, nominations, quotes, winners, trivia, awards, catego ry, reviews, dispatches, favorites, features, remove, writers, episodes, overview, appendchild, mysi mon, images, encodeuricomponent, special, createelement, credits, search, lights, summer, caused |
tv.com - rank der domain 1765 (712 in US)
|
| Arts/People/N/Nevin,_Brooke |
| zum Seitenanfang ↑ |
| Chowhound.com |
| Manhattan - Chowhound |
| http://www.chowhound.com/boards/18 |
| For those who live to eat. Non-commercial message board and information on great eating, hosted by r estaurant critic Jim Leff. |
| Tips for Dining, Eating, and Food Shopping in Manhattan |
| |
| manhattan, imgelem, document, recipe, general, uwsister, chowhound, restaurant, cooking, greater, an geles, return, archive, topics, boston, getelementbyid, daffyduck, england, francisco, atjsfo, chowh ounding, broadway, kathryn, newsletters, recipes, itrkid, houston, stories, summer, posted, nooyawka , autocomplete, scoopg, chowsue, recommendations, international, function, washington, obsessives, c entral, america, photos, plumpdumpling, supertaster, baltimore, parentelem, foodell, southwest, cana da, including, davina |
chowhound.com - rank der domain 358401 (142022 in US)
|
| Regional/North_America/United_States/New_York/Localities/N/New_York_City/Manhattan/Business_and_Economy/Restaurants_and_Bars/Guides_and_Directories |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/roguespear_pre/ |
| http://www.gamespot.com/features/roguespear_pre/ |
| Preview with screen shots. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, rainbow, return, document, schnurr, itrkid, parentelem, getelementbyid, because, gamespot, changes, success, release, requests, gamers, microsoft, netxp1, desturi, function, parentid, newuri, grenades, ctrkprefix, action, retail, itrkuri, enlarge, become, rbxcprefixed, software, numbers, ch ange, realism, unturned, especially, expecting, legions, sequel, enhance, series, relative, producer , publisher, newcomer, overarching, entertainment, spirit, realistic, either, things, technology |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Shooter/T/Tom_Clancy_Games/Rainbow_Six_Series/Rogue_Spear/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot |
| PAX '07: Day 1 wrap-up - News at GameSpot |
| http://www.gamespot.com/news/6177617.html |
| Ricardo Torres gives a wrap-up of day one of the 2007 expo. |
| The comic-strip-inspired gaming festival kicks off in Seattle for the fourth time, drawing a record crowd. |
| |
| posted, comment, disagree, imgelem, document, gamespot, nintendo, function, gaming, festival, return , comments, metroid, attendees, actually, script, seattle, interactive, exhibitors, itrkid, brother, stories, facebook, getelementbyid, rowleyfan3000, coverage, impressive, playable, godzilla, gamers, convention, tabletop, fantasy, because, content, believe, bigger, gamespot, sports, started, relate d, andreas, public, showed, corruption, original, before, connect, metacritic, parentelem, location |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Conventions/Penny_Arcade_Expo |
| zum Seitenanfang ↑ |
| GameFaqs |
| BloodRayne Cheats, Codes, and Secrets for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/code/542017.html |
| Includes cheat codes and walkthroughs. |
| For BloodRayne on the PC, GameFAQs has 10 cheat codes and secrets. |
| |
| document, imgelem, classname, getelementbyid, playstation, return, message, itrkid, bloodrayne, cont ainer, iphone, gamespot, parentelem, interactive, gamefaqs, nintendo, platforms, function, content, submission, advertise, previews, metacritic, college, cheats, advance, gamecube, itrkuri, parentid, saturn, rbxcprefixed, desturi, newuri, search, password, netxp1, arcade, ctrkprefix, dreamcast, gene sis, beacon, clearance, location, bargains, window, reviews, sitebnetcbs, rankings, comcbssports, ra nkingsvisit, download |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action-Adventure/Survival_Horror/BloodRayne_Series/BloodRayne |
| zum Seitenanfang ↑ |
| GameFAQs |
| Exit Release Information for PSP - GameFAQs |
| http://www.gamefaqs.com/portable/psp/data/929800.html |
| Release data and a message board. |
| For Exit on the PSP, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, layout, container, itrkid , interactive, parentelem, nintendo, platforms, gamefaqs, gamespot, genesis, college, designerhirosh i, advertise, abestage, designertomohito, metacritic, software, previews, corporationuljm, miscellan eous, effects, content, submission, itrkuri, beacon, saturn, gamecube, advance, search, arcade, pass word, dreamcast, function, designertohru, newuri, parentid, credits, netxp1, desturi, ctrkprefix, rb xcprefixed, mobile, around, cameras |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Puzzle/Exit |
| zum Seitenanfang ↑ |
| GameFAQs |
| Meteos Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/922233.html |
| Contains information and a message board. |
| For Meteos on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, container, iphone, meteos , gamespot, gamefaqs, parentelem, platforms, nintendo, interactive, beacon, techrepublic, college, s ubmission, review, previews, metacritic, advertise, miscellaneous, content, credits, gamecube, paren tid, search, ctrkprefix, advance, arcade, dreamcast, desturi, rbxcprefixed, netxp1, genesis, newuri, itrkuri, function, saturn, password, bargains, fmmaxprepsmetacritic, solutionsgamespotinternational last, clearance, comchowcnetcnet, comcbsnews, sitesselect, sportscbs |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Puzzle/Meteos |
| zum Seitenanfang ↑ |
| GameSpot |
| X-COM: Apocalypse Review for PC - GameSpot |
| http://www.gamespot.com/pc/strategy/xcomapocalypse/review.html |
| Review by Ron Dulin, [8.6] "This is almost the X-COM sequel that folks have been hoping for." |
| This is almost the X-COM sequel that folks have been hoping for. |
| X-COM: Apocalypse Review for PC, PC X-COM: Apocalypse Review, X-COM: Apocalypse Review, PC X-COM: Ap ocalypse, X-COM: Apocalypse for PC, X-COM: Apocalypse Article, X-COM: Apocalypse Hands On |
| apocalypse, imgelem, document, gamespot, combat, function, review, reviews, return, agents, geteleme ntbyid, script, player, itrkid, single, technology, instead, previous, equipment, cheats, connect, f acebook, score8, buildings, interactive, parentelem, primus, aliens, andreas, content, terror, reall y, almost, location, missions, interesting, interceptor, streets, between, summary, species, sports, college, reserved, showcase, cbsnews, cbsinteractive, researches, continue, studio, universe |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Strategy/Turn-Based/X-COM_Series/Apocalypse |
| zum Seitenanfang ↑ |
| GameFAQs |
| Electroplankton Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/926613.html |
| Provides data, and a message board. |
| For Electroplankton on the DS, the GameFAQs information page shows all known release data and credit s. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, gamespot, contain er, electroplankton, interactive, parentelem, nintendo, platforms, gamefaqs, metacritic, advance, ga mecube, review, beacon, submission, college, content, password, search, credits, advertise, itrkuri, parentid, previews, genesis, rbxcprefixed, newuri, desturi, dreamcast, netxp1, function, saturn, ar cade, ctrkprefix, hosting, overstock, clearance, information, comchowcnetcnet, comcbssports, comcbsn ews, solutionsgamespotinternationallast, fmmaxprepsmetacritic, commysimonncaasearch |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Music_and_Dance/Electroplankton |
| zum Seitenanfang ↑ |
| GameFAQs |
| Age of Empires III Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/925735.html |
| Release data and a message board. |
| For Age of Empires III on the PC, the GameFAQs information page shows all known release data and cre dits. |
| |
| imgelem, document, classname, playstation, return, empires, getelementbyid, itrkid, container, iphon e, parentelem, iiimicrosoft, platforms, netxp1, ctrkprefix, studiosx11, itrkuri, parentid, desturi, newuri, rbxcprefixed, advance, 05usage, gamecube, arcade, strategy, gamefaqs, password, dreamcast, n intendo, function, saturn, genesis, idrelease, better, online, dateregionage, datatitlecompanyproduc t, playrelease, rating, studiosesrb, tsystem, ensemble, historicdeveloper, datagenre, requirements, required, headphones, speakers, dorenartdon, pricestitle |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Strategy/Real-Time/Age_of_Empires_Series/Age_of_Empires_III |
| zum Seitenanfang ↑ |
| GameSpot |
| RollerCoaster Tycoon 3 Preview - PC Previews at GameSpot |
| http://www.gamespot.com/pc/strategy/rollercoastertycoon3/preview_6092089.html |
| Preview by Jason Ocampo, includes screenshots. |
| The third game in the blockbuster theme park-building franchise is going 3D and will even let you ri de the coasters. |
| |
| rollercoaster, tycoon, document, imgelem, gamespot, coasters, function, return, braben, roller, look ed, amusements, engine, script, previews, getelementbyid, graphics, visitors, interface, reviews, ch eats, images, itrkid, developer, design, frontier, expansion, sequel, series, working, location, dif ferent, gameplay, content, rsaquo, prices, everyone, player, connect, facebook, interactive, andreas , features, feature, differently, window, according, provide, parentelem, metacritic, preview |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Simulation/God_Games/Tycoon_Games/RollerCoaster_Tycoon_Series/RollerCoaster_Tycoon_3/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| CNET.com: DRM this, Sony! |
| DRM this, Sony! - CNET.com |
| http://www.cnet.com/4520-6033_1-6376177.html |
| Article by Molly Woods covering background and editorial options. |
| The Buzz Report |
| Molly Wood, Buzz, Daily Buzz, AnchorDesk |
| imgelem, document, technology, because, return, getelementbyid, digital, function, software, sidedoo r, weekly, november, products, height, itrkid, backdoor, phones, display, uninstall, trojan, compani es, notebooks, anchordesk, little, parentelem, window, piracy, rights, computer, illegal, remove, te levisions, windowheight, consumers, country, almighty, getelement, talkback, 6376177, technology, pa gevars, management, localvars, discovered, whatever, restrictions, leaves, itself, players, beginnin g, increasingly |
cnet.com - rank der domain 100 (49 in US)
|
| Society/Issues/Intellectual_Property/Digital_Rights_Management/Sony |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/freespace2_pre/ |
| http://www.gamespot.com/features/freespace2_pre/ |
| Preview |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, freespace, parentelem, volition, compelling, gamespot, descent, g etelementbyid, original, function, rbxcprefixed, action, innovations, elements, ctrkprefix, parentid , netxp1, itrkuri, desturi, newuri, freespace, destroying, models, without, simple, involving, lates t, exclusive, mysterious, graphics, believable, taking, creating, wingmen, sophisticated, commanding , opposed, interface, excellent, stunning, images, competition, features, solitary, seeming, dogfigh ts, exacerbated, already |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Shooter/D/Descent_Series/FreeSpace_2/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameFAQs: Revenant |
| Revenant FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/139180.html |
| Walkthroughs and user reviews. |
| For Revenant on the PC, GameFAQs has 3 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, revenant, gamespo t, container, gamefaqs, parentelem, nintendo, interactive, platforms, itrkuri, beacon, previews, met acritic, college, parentid, content, saturn, faqsfaq, function, search, gamecube, advance, arcade, d reamcast, genesis, rbxcprefixed, ctrkprefix, advertise, password, desturi, netxp1, newuri, comuwirew allstripzdnet, sports, solutionsgamespotinternationallast, cbssports, comtechrepublicthe, comshopper , commoblogicmp3, fmmaxprepsmetacritic, comurbanbaby, commysimonncaasearch, insidertv, cbsnews |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/R/Revenant/Cheats_and_Hints |
| zum Seitenanfang ↑ |
| GameFAQs |
| Zapper FAQs, Walkthroughs, and Guides for PlayStation 2 - GameFAQs |
| http://www.gamefaqs.com/console/ps2/game/561610.html |
| Contains PlayStation 2 walkthrough, with details of bonus stages. |
| For Zapper on the PlayStation 2, GameFAQs has 1 FAQ (game guide/walkthrough). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, zapper , interactive, nintendo, parentelem, gamespot, gamefaqs, platforms, itrkuri, newuri, college, conten t, beacon, parentid, advance, password, function, saturn, search, metacritic, genesis, desturi, rbxc prefixed, ctrkprefix, advertise, gamecube, arcade, dreamcast, netxp1, commysimonncaasearch, comshopp er, comtechrepublicthe, players, cbsnews, cbssports, solutions, international, sports, insidertv, co mmoblogicmp3, comurbanbaby, comuwirewallstripzdnet, comcbsnews |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/Z/Zapper |
| zum Seitenanfang ↑ |
| GameFAQs |
| Far Cry Vengeance Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/wii/data/934754.html |
| Cheats, reviews, and a message board. |
| For Far Cry Vengeance on the Wii, the GameFAQs information page shows all known release data and cre dits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, vengea nce, gamespot, parentelem, vengeanceubisoftrvl, gamefaqs, interactive, platforms, nintendo, beacon, techrepublic, submission, college, person, shooter, content, credits, action, advertise, netxp1, fun ction, genesis, advance, search, metacritic, password, gamecube, dreamcast, arcade, ctrkprefix, satu rn, itrkuri, parentid, newuri, rbxcprefixed, desturi, gamerankings, comchowcnetcnet, comcbssports, p layers, forums, comshopper, mobile |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Shooter/F/Far_Cry_Series/Far_Cry_Vengeance |
| zum Seitenanfang ↑ |
| GameFAQs |
| Time Ace Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/938139.html |
| FAQs, reviews, and a message board. |
| For Time Ace on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, container, parent elem, gamespot, interactive, gamefaqs, nintendo, platforms, insider, beacon, credits, submission, si mulation, content, futuristic, rbxcprefixed, advertise, saturn, function, metacritic, dreamcast, gen esis, password, newuri, parentid, search, itrkuri, release, desturi, gamecube, advance, netxp1, coll ege, ctrkprefix, arcade, comtechrepublicthe, sportscbs, comurbanbaby, insidertv, comshopper, radiocb s, commoblogicmp3, fmmaxprepsmetacritic, commysimonncaasearch |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Simulation/Flight/Time_Ace |
| zum Seitenanfang ↑ |
| CNet Mac OS Forum |
| Mac OS X Forum and Discussion - CNET Forums |
| http://forums.cnet.com/5204-6126_102-0.html?forumID=10 |
| Macintosh technical support forum. |
| Read Mac OS X discussions and get tips and advice on this topic and others on CNET Forums. |
| |
| document, forums, forumsearchheader, imgelem, forums, windows, function, return, margin, leopard, fo rumid, forumid, troubleshooting, macfixit, community, selection, forumsearchform, forumidinputelemen t, universalsearch, height, display, discussions, computer, hardware, itrkid, pagenumberbottom, soft ware, search, topics, popular, select, thread, interactive, search, pagenumbertop, showing, reviews, numoftotal, parentelem, moderators, getelementbyid, gamespot, mysimon, general, please, mrmacfixit, innerhtml, decoration, ffffff, pagevars, downloads |
cnet.com - rank der domain 100 (49 in US)
|
| Computers/Software/Operating_Systems/Mac_OS |
| zum Seitenanfang ↑ |
| GameFAQs: Theme Park |
| Theme Park Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/573894.html |
| Offers reader reviews for the PlayStation version. |
| For Theme Park on the PlayStation, GameFAQs has 7 reviews. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, gamesp ot, platforms, interactive, parentelem, nintendo, gamefaqs, beacon, content, rollercoaster, metacrit ic, advertise, college, netxp1, function, password, arcade, ctrkprefix, genesis, desturi, dreamcast, itrkuri, saturn, advance, parentid, newuri, reviews, gamecube, search, rbxcprefixed, radiocbs, comm oblogicmp3, fmmaxprepsmetacritic, commysimonncaasearch, comshopper, comtechrepublicthe, solutionsgam espotinternationallast, comchowcnetcnet, sitebnetcbs, sportscbs, comcbsnews, comcbssports, sitessele ct |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Simulation/God_Games/Theme_Games/Theme_Park_Series |
| zum Seitenanfang ↑ |
| GameFAQs: Arc the Lad III |
| Arc the Lad III FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/game/576155.html |
| Includes walkthroughs and frequently asked questions. |
| For Arc the Lad III on the PlayStation, GameFAQs has 18 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, container, parent elem, gamespot, platforms, gamefaqs, interactive, nintendo, beacon, content, metacritic, walkthrough 12, advertise, college, saturn, function, genesis, advance, search, password, gamecube, dreamcast, a rcade, netxp1, parentid, desturi, rbxcprefixed, ctrkprefix, itrkuri, newuri, sitebnetcbs, previews, reviews, sitesselect, bargains, comcbsnews, solutionsgamespotinternationallast, fmmaxprepsmetacritic , commoblogicmp3, resourcesgame, rankingsvisit, radiocbs, rankings, comcbssports |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad_III |
| zum Seitenanfang ↑ |
| GameFAQs |
| Bomberman Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/920766.html |
| Offers information and a message board. |
| For Bomberman on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, container, bomber man, gamespot, interactive, platforms, nintendo, parentelem, gamefaqs, metacritic, content, college, abmp07, credits, hudson, previews, miscellaneous, advertise, password, beacon, function, netxp1, ct rkprefix, gamecube, saturn, genesis, dreamcast, arcade, search, advance, submission, parentid, itrku ri, desturi, newuri, rbxcprefixed, comchowcnetcnet, comcbssports, speakers, radiocbs, laptops, camer as, sportscbs, sitebnetcbs |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/B/Bomberman_Series/Bomberman_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| Break 'Em All Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/932722.html |
| Release data and a message board. |
| For Break 'Em All on the DS, the GameFAQs information page shows all known release data and cre dits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, gamespot, itrkid, container, ipho ne, interactive, parentelem, nintendo, platforms, gamefaqs, submission, content, advertise, advance, saturn, beacon, credits, search, password, action, college, gamecube, netxp1, dreamcast, rbxcprefix ed, ctrkprefix, genesis, desturi, arcade, metacritic, itrkuri, function, newuri, parentid, insidertv , sitesselect, radiocbs, comshopper, solutionsgamespotinternationallast, fmmaxprepsmetacritic, commy simonncaasearch, comtechrepublicthe, comchowcnetcnet, sportscbs, commoblogicmp3, comcbsnews |
gamefaqs.com - rank der domain 913 (391 in US)
|
|
| zum Seitenanfang ↑ |
| GameSpot |
| Bomberman Land Hands-On - Wii Previews at GameSpot |
| http://www.gamespot.com/wii/action/bombermanland/news.html?sid=6183461&mode=recent |
| Preview, by Justin Calvert: "While we're not nearly as excited for the story mode as we are for the old-school battles, we did manage to have some fun along the way." |
| We spend some quality time with a near-finished US version of Bomberman's first Wii adventure. |
| |
| bomberman, posted, comment, disagree, imgelem, document, online, minigames, bomberman, gamespot, fun ction, return, review, script, hudson, version, without, battle, previews, getelementbyid, because, itrkid, rsaquo, minigame, looked, different, everyone, simply, images, nintendo, graphics, content, reviews, cheats, people, around, hudson, enjoyed, another, everyone, interactive, button, players, b etter, reason, playing, latest, hunter, message, deleted, request |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Action/B/Bomberman_Series/Bomberman_Land |
| zum Seitenanfang ↑ |
| GameFAQs |
| Polarium Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/925392.html |
| Contains release data and a message board. |
| For Polarium on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, gamespot, itrkid, contain er, polarium, interactive, graphic, parentelem, nintendo, platforms, gamefaqs, credits, submission, previews, content, designshoichi, american, programmingakihiro, kumagaimain, koikesound, advertise, designmikako, asnp03, college, metacritic, designdaisuke, miscellaneous, dreamcast, arcade, genesis, newuri, parentid, search, advance, netxp1, desturi, rbxcprefixed, ctrkprefix, function, saturn, itr kuri, gamecube, beacon, password, laptops |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Puzzle/Polarium |
| zum Seitenanfang ↑ |
| GameFAQs |
| Seed Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/931232.html |
| Release data and a message board. |
| For Seed on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, intera ctive, parentelem, gamefaqs, nintendo, gamespot, platforms, beacon, advertise, college, content, met acritic, submission, massively, playing, multiplayer, online, netxp1, arcade, dreamcast, gamecube, c trkprefix, search, advance, desturi, genesis, saturn, function, newuri, rbxcprefixed, password, itrk uri, parentid, fmmaxprepsmetacritic, players, location, digital, phones, commoblogicmp3, commysimonn caasearch, comurbanbaby, comuwirewallstripzdnet, sports |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/Massive_Multiplayer_Online/Seed |
| zum Seitenanfang ↑ |
| Gamespot |
| Outwars Review for PC - GameSpot |
| http://www.gamespot.com/pc/action/outwars/review.html |
| Review by Stephen Poole, scoring 7.8/10 : "It's definitely worth trying, and you might even wind up loving it." |
| The very things that make it unique and interesting are also the source of some of its most frustrat ing aspects. |
| Outwars Review for PC, PC Outwars Review, Outwars Review, PC Outwars, Outwars for PC, Outwars Articl e, Outwars Hands On |
| imgelem, outwars, document, gamespot, function, reviews, return, review, getelementbyid, script, jet pack, player, combat, action, though, cheats, itrkid, missions, several, interactive, things, parent elem, facebook, connect, pretty, weapons, graphics, andreas, jetpacks, location, score7, attacks, sp orts, cbssports, cbsnews, cbsinteractive, articles, because, college, platform, another, especially, looked, couple, scores, critic, attack, better, unlimited, around, medkits |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Shooter/O/Outwars |
| zum Seitenanfang ↑ |
| GameFAQs |
| Daemonica Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/926011.html |
| Release data, and a message board. |
| For Daemonica on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, daemonica, container, itrkid, iph one, compliant, directx, parentelem, gamefaqs, gamespot, cbsiadglobal, interactive, nintendo, platfo rms, genesis, netxp1, college, arcade, gamecube, advance, person, search, content, support, adventur e, dreamcast, submission, newuri, beacon, metacritic, advertise, parentid, itrkuri, saturn, desturi, rbxcprefixed, ctrkprefix, password, function, solutionsgamespotinternationallast, fmmaxprepsmetacri tic, mobile, comchowcnetcnet, commoblogicmp3, gamerankings, comcbssports |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action-Adventure/D/Daemonica |
| zum Seitenanfang ↑ |
| TV.com: Amanda Seyfried |
| Amanda Seyfried on TV.com |
| http://www.tv.com/amanda-seyfried/person/143056/summary.html |
| Biography, roles and appearances, and forum. |
| |
| Amanda Seyfried, , photos, videos, life, biography, career, credits |
| imgelem, return, document, videos, itrkid, amanda, background, parentelem, getelementbyid, seyfried, parentid, newuri, itrkuri, netxp1, function, desturi, photos, people, ctrkprefix, rbxcprefixed, hea der, height, adinfo, features, position, quotes, reviews, trivia, overview, credits, lights, favorit es, remove, earrings, images, appendchild, encodeuricomponent, createelement, search, diamond, summe r, mysimon, lights, common, special, center, disabled, javascript, result, import, enabled |
tv.com - rank der domain 1765 (712 in US)
|
| Arts/Performing_Arts/Acting/Actors_and_Actresses/S/Seyfried,_Amanda |
| zum Seitenanfang ↑ |
| Gamespot - Mortal Kombat Gold Interview |
| Mortal Kombat Gold Interview - News at GameSpot |
| http://www.gamespot.com/news/2450709.html |
| Interview with Eurocom about the game. |
| Discover what UK-based Eurocom is cooking up for the next coming of Mortal Kombat. |
| |
| eurocom, kombat, imgelem, mortal, gamespot, document, posted, dreamcast, character, function, weapon , return, versions, arcade, allows, textures, characters, comments, second, created, number, intervi ew, script, itrkid, previous, possible, addition, facebook, geometry, stories, polygon, currently, r esolution, special, features, hardware, stages, graphical, kitana, models, graphics, gameplay, addit ional, andreas, making, provided, studio, chicago, interactive, million, implement |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Fighting/Mortal_Kombat_Series/Mortal_Kombat_Gold |
| zum Seitenanfang ↑ |
| GameSpot |
| Tom Clancy's Rainbow Six 3: Black Arrow Preview - Xbox Previews at GameSpot |
| http://www.gamespot.com/xbox/action/rainbowsix3blackarrow/preview_6102365.html |
| Previewed by Brad Shoemaker, with screen shots and a gameplay movie. |
| Ding Chavez and his team will protect the free world, once again, on your Xbox this August. |
| |
| rainbow, clancy, imgelem, document, original, return, getelementbyid, splinter, pretty, campaign, ga mespot, without, considerable, online, mission, through, itrkid, rsaquo, multiplayer, features, cont rol, course, parentelem, ubisoft, images, department, player, before, gamers, score8, settings, figh ting, reviews, exactly, prices, experience, biggest, addition, anyone, desturi, essentially, expansi on, should, parentid, predecessor, newuri, although, gameplay, rbxcprefixed, visual, preview |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Shooter/T/Tom_Clancy_Games/Rainbow_Six_Series/Black_Arrow/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot |
| SoulCalibur Review for Dreamcast - GameSpot |
| http://www.gamespot.com/dreamcast/action/soulcalibur/review.html |
| Rated 10/10 by James Mielke, "state of the art." |
| Think state of the art. |
| SoulCalibur Review for Dreamcast, Dreamcast SoulCalibur Review, SoulCalibur Review, Dreamcast SoulCa libur, SoulCalibur for Dreamcast, SoulCalibur Article, SoulCalibur Hands On |
| imgelem, document, gamespot, soulcalibur, calibur, function, reviews, dreamcast, review, fighting, r eturn, tekken, getelementbyid, script, player, playstation, version, graphics, system, itrkid, chara cters, cheats, effects, arcade, extremely, gamespot, parentelem, content, character, location, conne ct, facebook, techrepublic, hardware, interactive, fireworks, perfect, models, spikes, example, poly gonal, looking, polygon, rendered, capcom, person, despite, weapons, articles, moneywatch, metacriti c |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Fighting/Soul_Calibur_Series/Soul_Calibur/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| GameSpot |
| NASCAR 2005: Chase for the Cup Impressions - Xbox Previews at GameSpot |
| http://www.gamespot.com/xbox/driving/nascarthunder2005/preview_6102792.html |
| Previewed by Jason Ocampo. Includes gameplay movie. [Xbox] |
| EA is completely overhauling its NASCAR series with its next installment. Learn all about the signif icant changes it's undergoing. |
| |
| nascar, imgelem, document, return, getelementbyid, versions, driver, racing, points, itrkid, gamespo t, console, season, version, score8, behind, parentelem, images, system, someone, sports, reviews, i ntimidator, addition, changes, prices, feature, series, newuri, desturi, ctrkprefix, rbxcprefixed, p arentid, itrkuri, netxp1, player, easily, previews, impressions, modified, function, circuit, review , another, because, studio, should, comment, newman, against, rsaquo |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Driving_and_Racing/Simulations/NASCAR_Games/NASCAR_Series/NASCAR_2005_-_Chase_for_the_Cup/Reviews_and_Previews |
| zum Seitenanfang ↑ |
| TV.com: Robert O. Smith |
| Robert O. Smith on TV.com |
| http://www.tv.com/robert-o-smith/person/101499/summary.html |
| The television reference guide includes credits for Robert O. |
| |
| Robert O. Smith, , photos, videos, life, biography, career, credits |
| imgelem, document, return, videos, itrkid, getelementbyid, parentelem, robert, desturi, function, rb xcprefixed, ctrkprefix, parentid, newuri, itrkuri, connect, fbhost, photos, people, netxp1, awards, category, lights, winners, search, episodes, images, trivia, credits, overview, quotes, reviews, fav orites, remove, protagonists, pantless, createelement, gamefaqs, appendchild, height, encodeuricompo nent, unescape, 3cscript, static, facebook, featureloader, protocol, location, region, secure, 12792 87803 |
tv.com - rank der domain 1765 (712 in US)
|
| Arts/Animation/Voice_Actors/S/Smith,_Robert_O. |
| zum Seitenanfang ↑ |
| GameFAQs |
| Crysis Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/931665.html |
| Release data, and a message board. |
| For Crysis on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, itrkid, container, cbsiadglobal, iphone, parentelem, platforms, shooter, ctrkprefix, action, desturi, person, parentid, itrkuri, newu ri, rbxcprefixed, function, netxp1, dreamcast, genesis, gamecube, gamefaqs, password, advance, arcad e, saturn, nintendo, takeover, global, cookie, gfebforcestreaming, firstpage, detect, undefined, tak eover, typeof, msystem, gamesanswersboardcheck, ficrysishomedatafaqscheatsreviewsimagesvideosmy, pri cestitle, datagenre, crytekesrb, fideveloper, rating, requirements, gamefaqs |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Shooter/C/Crysis |
| zum Seitenanfang ↑ |
| GameSpot's Circle of Blood Walkthrough |
| GameSpot - /features/circle/ |
| http://www.gamespot.com/features/circle/ |
| Complete path through game. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, george, parentelem, gamespot, getelementbyid, getting, through, h istory, rbxcprefixed, desturi, ctrkprefix, function, information, netxp1, french, murder, newuri, an other, itrkuri, parentid, ireland, several, locations, nevertheless, motivation, approaching, closes t, layers, puzzles, circle, conversations, canyon, flavors, investigator, branches, conversational, richer, contacts, different, determine, liberally, detailed, questions, responses, particular, topic s, affect, sources |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Broken_Sword_Series/Broken_Sword_-_The_Shadow_of_the_Templars |
| zum Seitenanfang ↑ |
| GameFAQs |
| Final Fantasy VIII Reviews for PlayStation - GameFAQs |
| http://www.gamefaqs.com/console/psx/review/197343.html |
| A collection of submitted reviews by users. |
| For Final Fantasy VIII on the PlayStation, GameFAQs has 113 reviews. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, container, iphone, parent elem, platforms, desturi, rbxcprefixed, advance, newuri, ctrkprefix, parentid, fantasy, itrkuri, pas sword, gamefaqs, netxp1, dreamcast, nintendo, genesis, arcade, gamecube, function, saturn, gamefaqs, firstpage, jumper, cookie, domain, viiihomedatafaqscheatssavesreviewsimagesvideosmy, aganar10, squa resoft, reviewswow, detailed, console, playing, rpgfinal, pricesgamefaqs, gamesanswersboardcheck, pl atform, leader, appendchild, height, createelement, forgot, search |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/F/Final_Fantasy_Games/Final_Fantasy_VIII/Reviews_and_Previews/PlayStation |
| zum Seitenanfang ↑ |
| GameFAQs: Ultima III |
| Ultima III: Exodus FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/562659.html |
| Walkthrough. |
| For Ultima III: Exodus on the PC, GameFAQs has 8 FAQs (game guides and walkthroughs). |
| |
| document, imgelem, classname, playstation, return, getelementbyid, iphone, itrkid, container, gamesp ot, interactive, parentelem, nintendo, ultima, platforms, gamefaqs, exodus, saturn, beacon, search, advance, gamecube, password, content, college, advertise, metacritic, genesis, rbxcprefixed, ctrkpre fix, function, netxp1, desturi, dreamcast, arcade, parentid, itrkuri, newuri, fmmaxprepsmetacritic, commysimonncaasearch, insidertv, commoblogicmp3, cbsnews, sports, comurbanbaby, comtechrepublicthe, comshopper, comuwirewallstripzdnet, cbssports, laptops, speakers |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/U/Ultima_Series/Ultima_III_-_Exodus |
| zum Seitenanfang ↑ |
| GameFAQs |
| 1701 A.D. Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/932832.html |
| Release data, and a message board. |
| For 1701 A.D. on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, container, iphone, itrkid, intera ctive, gamefaqs, gamespot, parentelem, platforms, nintendo, credits, designerdirk, designersebastian , college, content, advertise, metacritic, strategy, beacon, genesis, function, dreamcast, submissio n, password, release, search, arcade, gamecube, advance, saturn, ctrkprefix, itrkuri, rbxcprefixed, netxp1, desturi, parentid, newuri, hosting, overstock, gameplay, phones, digital, cameras, laptops, speakers, bargains |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Strategy/Real-Time/Anno_Series/1701 |
| zum Seitenanfang ↑ |
| GameFAQs |
| Perimeter Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/914468.html |
| Cheats, reviews, and a message board. |
| For Perimeter on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, perime ter, gamespot, nintendo, platforms, parentelem, gamefaqs, interactive, metacritic, submission, adver tise, credits, college, strategy, content, beacon, saturn, function, netxp1, advance, search, passwo rd, gamecube, arcade, genesis, dreamcast, ctrkprefix, parentid, newuri, itrkuri, previews, rbxcprefi xed, desturi, fmmaxprepsmetacritic, solutionsgamespotinternationallast, clearance, bargains, commobl ogicmp3, around, rankings, radiocbs, reviews, comcbsnews |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Strategy/Real-Time/Perimeter_Series/Perimeter |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/dung2_int/ |
| http://www.gamespot.com/features/dung2_int/ |
| Interview and screen shots. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, gamespot, itrkid, keeper, parentelem, dungeon, better, features, geteleme ntbyid, player, original, opponent, enlarge, desturi, rbxcprefixed, newuri, itrkuri, parentid, ctrkp refix, netxp1, function, goldsworthy, another, attract, creatures, combat, underestimated, creature, another, feature, overpowers, determined, possible, playable, importantly, balancing, redesigning, multiplayer, turned, multiplayer, server, experience, central, playing, entice, angels, supply, knig hts, counteract |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/Strategy/Real-Time/Dungeon_Keeper_Series/Dungeon_Keeper_2 |
| zum Seitenanfang ↑ |
| GameFAQs |
| Crimson Skies FAQs, Walkthroughs, and Guides for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/game/914280.html |
| Walkthrough and codes. |
| For Crimson Skies on the PC, GameFAQs has 2 FAQs (game guides and walkthroughs). |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, crimson, containe r, gamespot, interactive, parentelem, nintendo, platforms, gamefaqs, search, advance, beacon, arcade , password, gamecube, advertise, metacritic, function, previews, content, college, saturn, newuri, p arentid, rbxcprefixed, desturi, ctrkprefix, itrkuri, dreamcast, netxp1, genesis, cbssports, comcbssp orts, comchowcnetcnet, comcbsnews, sportscbs, radiocbs, cbsnews, solutionsgamespotinternationallast, commysimonncaasearch, comshopper, comtechrepublicthe, insidertv, commoblogicmp3 |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Roleplaying/C/Crimson_Skies_Series/Crimson_Skies |
| zum Seitenanfang ↑ |
| GameFAQs |
| Wii Play Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/wii/data/935589.html |
| FAQs, cheats, reviews, and a message board. |
| For Wii Play on the Wii, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, container, ninten do, interactive, gamespot, gamefaqs, parentelem, platforms, techrepublic, submission, content, colle ge, rhap12, playnintendorvl, metacritic, wiinintendorvl, miscellaneous, system, previews, shibataui, advertise, remote, nintendorvl, itrkuri, beacon, saturn, function, genesis, password, search, advan ce, dreamcast, arcade, gamecube, parentid, newuri, credits, ctrkprefix, netxp1, rbxcprefixed, destur i, gamerankings, speakers, mobile |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/W/Wii_Play |
| zum Seitenanfang ↑ |
| GameFAQs |
| War Rock Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/931206.html |
| FAQs, reviews, and a message board. |
| For War Rock on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, container, ninten do, gamefaqs, gamespot, interactive, platforms, parentelem, beacon, submission, action, person, shoo ter, advertise, credits, content, saturn, function, genesis, advance, search, gamecube, arcade, drea mcast, parentid, rbxcprefixed, desturi, newuri, itrkuri, college, metacritic, netxp1, ctrkprefix, pa ssword, insidertv, fmmaxprepsmetacritic, comtechrepublicthe, commoblogicmp3, radiocbs, comchowcnetcn et, comcbssports, comshopper, comcbsnews, solutionsgamespotinternationallast |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/W/War_Rock |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/bestworst96/ |
| http://www.gamespot.com/features/bestworst96/ |
| Picks for the best and worst of 1996. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, itrkid, gamespot, parentelem, getelementbyid, gaming, winners, ctrkprefix , rbxcprefixed, function, netxp1, desturi, itrkuri, newuri, parentid, originality, effectively, inno vative, between, greater, things, technology, sequels, improvement, explosion, multiplayer, countere d, blockbuster, continued, demanded, strategy, category, surprisingly, enough, serious, section, con tenders, included, threat, victor, winner, declared, details, writers, contributing, awards, determi ne, ballots, tallied |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/News_and_Reviews/Awards/1996 |
| zum Seitenanfang ↑ |
| GameFAQs |
| SWAT 4 Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/920508.html |
| FAQs, cheats, reviews, and a message board. |
| For SWAT 4 on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, engine, playstation, classname, return, getelementbyid, iphone, itrkid, container , officer, gamespot, interactive, parentelem, platforms, gamefaqs, nintendo, content, submission, se arch, gamecube, advance, function, credits, action, entertainment04, shooter, 4sierra, person, netxp 1, metacritic, password, review, previews, advertise, parentid, saturn, itrkuri, college, ctrkprefix , desturi, rbxcprefixed, newuri, dreamcast, arcade, beacon, genesis, mobile, around, digital, moviet ome |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Adventure/Graphical_Adventures/Police_Quest_Series/SWAT_Series/SWAT_4 |
| zum Seitenanfang ↑ |
| GameFAQs |
| Heatseeker Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/wii/data/935985.html |
| FAQs, cheats, images, and a message board. |
| For Heatseeker on the Wii, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, gamespot, heatseeker, iphone, con tainer, itrkid, nintendo, parentelem, interactive, platforms, gamefaqs, beacon, simulation, credits, college, modern, content, flight, submission, previews, saturn, advertise, function, genesis, searc h, password, metacritic, advance, gamecube, dreamcast, arcade, netxp1, itrkuri, rbxcprefixed, destur i, ctrkprefix, newuri, parentid, fmmaxprepsmetacritic, commoblogicmp3, sitemap, solutionsgamespotint ernationallast, movietome, insidertv, comurbanbaby, comuwirewallstripzdnet |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Simulation/Flight/Heatseeker |
| zum Seitenanfang ↑ |
| GameFAQs |
| Zoo Tycoon 2 Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/919850.html |
| Cheats, reviews, and a message board. |
| For Zoo Tycoon 2 on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, tycoon, classname, playstation, return, getelementbyid, iphone, container, itrkid , gamespot, 2microsoft, interactive, parentelem, nintendo, gamefaqs, platforms, advance, strategy, c ontent, metacritic, beacon, gamecube, college, submission, previews, credits, password, ctrkprefix, saturn, function, advertise, netxp1, genesis, dreamcast, itrkuri, arcade, studios11, parentid, destu ri, rbxcprefixed, newuri, search, comchowcnetcnet, movietome, solutionsgamespotinternationallast, co murbanbaby, comuwirewallstripzdnet, sports, gamerankings, comcbssports |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Simulation/God_Games/Tycoon_Games/Zoo_Tycoon_Series/Zoo_Tycoon_2 |
| zum Seitenanfang ↑ |
| GameSpot |
| GameSpot - /features/1999/ |
| http://www.gamespot.com/features/1999/ |
| Picks for the best and worst of 1999. |
| Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more! |
| |
| imgelem, return, document, gamespot, itrkid, getelementbyid, difficult, parentelem, released, surpas s, newuri, excellent, ctrkprefix, function, rbxcprefixed, netxp1, itrkuri, parentid, desturi, qualit y, freespace, starcraft, matched, number, disappoint, seemed, doomed, appeared, included, unlikely, developers, fandango, readers, choice, awards, selections, presents, ballot, disagree, category, pro ved, homeworld, racing, empires, select, representative, surprise, though, selection, nascar, select ing |
gamespot.com - rank der domain 618 (258 in US)
|
| Games/Video_Games/News_and_Reviews/Awards/1999 |
| zum Seitenanfang ↑ |
| GameFAQs |
| SimCity DS Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/935403.html |
| Cheats, reviews, images, and a message board. |
| For SimCity DS on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, artsntr, containe r, simcity, platforms, parentelem, interactive, gamefaqs, dselectronic, gamespot, nintendo, techrepu blic, strategy, college, content, beacon, advertise, submission, metacritic, building, credits, dest uri, genesis, advance, netxp1, gamecube, function, parentid, itrkuri, saturn, newuri, search, rbxcpr efixed, ctrkprefix, arcade, dreamcast, password, sitesselect, sportscbs, sitebnetcbs, comcbssports, comshopper, comtechrepublicthe, insidertv |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Simulation/God_Games/Sim_Games/SimCity_Series/SimCity_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| Elebits Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/wii/data/933005.html |
| FAQs, cheats, reviews, and a message board. |
| For Elebits on the Wii, the GameFAQs information page shows all known release data and credits. |
| |
| object, imgelem, document, classname, playstation, return, system, getelementbyid, iphone, itrkid, c ontainer, gamespot, elebits, parentelem, interactive, nintendo, platforms, gamefaqs, previews, metac ritic, submission, action, artistyukiko, eikagame, relp05, artisthiroaki, programmertakuro, suzukiop ening, programmertakeshi, artisttomohiro, content, college, artistshigeya, programmerkazuya, genesis , beacon, saturn, dreamcast, credits, password, search, advance, arcade, gamecube, function, newuri, parentid, itrkuri, advertise, desturi, rbxcprefixed |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/E/Elebits |
| zum Seitenanfang ↑ |
| GameFAQs |
| X3: Reunion Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/927012.html |
| FAQs, cheats, and a message board. |
| For X3: Reunion on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, reunion, return, getelementbyid, iphone, container, games pot, itrkid, content, parentelem, nintendo, gamefaqs, interactive, platforms, simulation, advertise, metacritic, college, beacon, previews, programmingsebastian, credits, submission, edition, function , arcade, saturn, search, advance, newuri, dreamcast, gamecube, parentid, itrkuri, desturi, netxp1, password, genesis, rbxcprefixed, ctrkprefix, players, phones, sitebnetcbs, sportscbs, digital, sites select, laptops, clearance |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/Space_Combat/X_Series/X3_-_Reunion |
| zum Seitenanfang ↑ |
| GameFAQs |
| Picross DS Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/936532.html |
| FAQs, cheats, reviews, and a message board. |
| For Picross DS on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, dsnintendontr, getelementbyid, picross, itrkid, i phone, container, platforms, interactive, parentelem, gamefaqs, nintendo, gamespot, beacon, credits, college, metacritic, puzzle, advertise, password, newuri, saturn, miscellaneous, genesis, gamecube, advance, arcade, dreamcast, function, desturi, rbxcprefixed, itrkuri, parentid, content, submission , search, ctrkprefix, netxp1, phones, players, sitebnetcbs, bargains, sitesselect, radiocbs, sportsc bs, clearance, laptops |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Puzzle/Picross_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| AquaNox Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/447287.html |
| Provides information, help, codes, and a message board. |
| For AquaNox on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, aquanox, parentelem, platforms, interactive, gamefaqs, nintendo, advertise, beacon, college, sim ulation, password, futuristic, previews, submission, credits, itrkuri, saturn, function, dreamcast, arcade, genesis, desturi, newuri, metacritic, parentid, rbxcprefixed, netxp1, content, search, gamec ube, ctrkprefix, advance, comshopper, comtechrepublicthe, sitesselect, comcbsnews, comcbssports, com chowcnetcnet, solutionsgamespotinternationallast, radiocbs, fmmaxprepsmetacritic |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Action/A/AquaNox_Series/AquaNox |
| zum Seitenanfang ↑ |
| GameFAQs |
| Red Steel Release Information for Wii - GameFAQs |
| http://www.gamefaqs.com/console/revolution/data/932528.html |
| Release data, and a message board. |
| For Red Steel on the Wii, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, steelu bisoftrvl, parentelem, gamespot, gamefaqs, interactive, platforms, nintendo, techrepublic, submissio n, advertise, metacritic, action, credits, college, redp12, content, shooter, person, beacon, search , advance, gamecube, function, netxp1, arcade, genesis, dreamcast, saturn, rbxcprefixed, ctrkprefix, review, newuri, previews, parentid, itrkuri, password, desturi, solutionsgamespotinternationallast, comcbssports, comchowcnetcnet, rankings, comcbsnews |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Shooter/R/Red_Steel |
| zum Seitenanfang ↑ |
| GameFAQs |
| Rayman DS Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/924893.html |
| Data, cheats, reviews, and a message board. |
| For Rayman DS on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, rayman, iphone, container, itrkid , gamespot, interactive, parentelem, nintendo, gamefaqs, platforms, college, metacritic, credits, pa ssword, beacon, gamecube, action, submission, content, search, advance, dsubisoftntr, genesis, rbxcp refixed, netxp1, advertise, saturn, ctrkprefix, desturi, arcade, function, dreamcast, itrkuri, newur i, parentid, comchowcnetcnet, movietome, comcbssports, insidertv, comcbsnews, comurbanbaby, comuwire wallstripzdnet, comtechrepublicthe, gamerankings, fmmaxprepsmetacritic |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Platform/Rayman_Series/Rayman_DS |
| zum Seitenanfang ↑ |
| GameFAQs |
| 25 to Life Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/926658.html |
| Provides release data and a message board. |
| For 25 to Life on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, gamefaqs, interactive, platforms, nintendo, parentelem, action, shooter, advertise, college, con tent, beacon, metacritic, previews, credits, submission, person, detective, dreamcast, arcade, newur i, function, saturn, itrkuri, gamecube, advance, netxp1, search, password, ctrkprefix, desturi, rbxc prefixed, parentid, genesis, gameplay, speakers, bargains, clearance, screenshots, hosting, overstoc k, comcbsnews |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Shooter/2/25_to_Life |
| zum Seitenanfang ↑ |
| GameFAQs PSP |
| Sticky Balls Release Information for PSP - GameFAQs |
| http://www.gamefaqs.com/portable/psp/data/920837.html |
| Data and a message board. |
| For Sticky Balls on the PSP, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, sticky, container , platforms, gamefaqs, parentelem, gamespot, nintendo, interactive, submission, gamecube, advertise, college, advance, beacon, content, miscellaneous, newuri, saturn, function, dreamcast, genesis, met acritic, desturi, rbxcprefixed, parentid, arcade, search, password, netxp1, ctrkprefix, itrkuri, sol utionsgamespotinternationallast, sports, comurbanbaby, comuwirewallstripzdnet, insidertv, comtechrep ublicthe, fmmaxprepsmetacritic, commoblogicmp3, commysimonncaasearch, comshopper, cbsnews, digital |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Puzzle/Sticky_Balls |
| zum Seitenanfang ↑ |
| GameFAQs |
| Zoo Keeper Release Information for DS - GameFAQs |
| http://www.gamefaqs.com/portable/ds/data/924607.html |
| Contains information, FAQs, cheats, and a message board. |
| For Zoo Keeper on the DS, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, keeper, getelementbyid, itrkid, iphone, container , gamespot, platforms, interactive, keeperignition, gamefaqs, entertainmentntr, parentelem, nintendo , miscellaneous, advertise, college, content, beacon, metacritic, credits, azkp03, submission, passw ord, function, netxp1, newuri, parentid, desturi, rbxcprefixed, saturn, arcade, gamecube, dreamcast, genesis, advance, search, itrkuri, ctrkprefix, comscore, bargains, forgot, clearance, speakers, hos ting, overstock, sitesselect |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Puzzle/Zoo_Keeper |
| zum Seitenanfang ↑ |
| GameFAQs |
| Spore Release Information for PC - GameFAQs |
| http://www.gamefaqs.com/computer/doswin/data/926714.html |
| Information, links, and a message board. |
| For Spore on the PC, the GameFAQs information page shows all known release data and credits. |
| |
| imgelem, document, classname, playstation, return, games09, getelementbyid, container, itrkid, iphon e, engineer, gamefaqs, parentelem, gamespot, edition, interactive, platforms, galactic, nintendo, be acon, strategy, advertise, breeding, metacritic, credits, parentid, genesis, function, content, satu rn, dreamcast, arcade, submission, password, release, college, gamecube, advance, search, rbxcprefix ed, review, newuri, desturi, itrkuri, netxp1, previews, ctrkprefix, bargains, players, sitesselect, digital |
gamefaqs.com - rank der domain 913 (391 in US)
|
| Games/Video_Games/Simulation/God_Games/Spore |
| zum Seitenanfang ↑ |
|