refertus.info Sitemap.XML / Sitemap.HTML / search / Kontakt & Impressum / Domains
refertus.info
  ordered by rank        
 
البيّنة
http://www.albainah.net/
الموسوعة السنيّة في الشيعة الإثني عشريّة.
document, getelementbyid, tempel, function, imgelem, return, iemarquee, offsetparent, calenderid, tx tsearchword, docjslib, anothercalenderid, script, display, parseint, offsettop, offsetleft, scrollma rquee, copyspeed, window, showcalender, validate, setinterval, offsetwidth, getrealleft, javascript, location, protocol, setaccount, 17523802, trackpageview, createelement, validatesearch, getrealtop, pausespeed, insertbefore, parentnode, analytics, google, getelementsbytagname, marqueespeed
albainah.net - rank der domain 941355 (2187 in SA)
World/Arabic/مجتمع/أديان_و_معتقدات/وجهات_نظر_معارضة/إسلام/شيعة
zum Seitenanfang ↑
البيّنة
http://www.albainah.net/
الموسوعة السنيّة في الشيعة الإثني عشريّة.
document, getelementbyid, tempel, function, imgelem, return, iemarquee, offsetparent, calenderid, tx tsearchword, docjslib, anothercalenderid, script, display, parseint, offsettop, offsetleft, scrollma rquee, copyspeed, window, showcalender, validate, setinterval, offsetwidth, getrealleft, javascript, location, protocol, setaccount, 17523802, trackpageview, createelement, validatesearch, getrealtop, pausespeed, insertbefore, parentnode, analytics, google, getelementsbytagname, marqueespeed
albainah.net - rank der domain 941355 (2187 in SA)
World/Arabic/إقليمـي/الشرق_الأوسط/السعودية/مجتمع/إسلام/مذاهب_و_فرق
zum Seitenanfang ↑
imgelem
imgelem
zum Seitenanfang ↑
CNET TV
http://www.cnettv.com
Video broadcasts of technology news, product information and ways to get the most out of your tech.
iphone, notebooks, imgelem, cnettv, function, todaysplaylist, looking, return, display, ctvvalue, ad dparam, ctvname, document, laptop, macbook, ctvtype, isparent, phones, lenovo, netbook, android, img alt, imgpath, samsung, series, window, itrkid, popular, player, userbucket, qvalue, addevent, domrea dy, reasons, pagetype, twitter, interactive, compact, getelementbyid, sprint, google, tekzilla, heig ht, parentelem, screensaver, intercept, ericsson, smartphones, podcast, episode, xperia
(SLD : cnettv.com)
News/Internet_Broadcasts
zum Seitenanfang ↑
First Presbyterian Church, Morris, Illinois
First Presbyterian Church, Morris
http://firstpresmorris.org/
Contact information and directions.
document, tempel, visibility, function, imgelem, divobj2, myarray, getelementbyid, divarray, return, gcount, length, divobj, netscape, explorer, menudiv, hidden, presbyterian, positionx, positiony, la yers, offsetparent, getrealtop, joseph, getrealleft, church, prepdhtmlmenu1, through, visible, frida y, events, presbyts, morris, window, service, religous, zindex, offsetleft, offsettop, prepdhtmlmenu 2, information, calendar, edstronghold, inyouthsenior, presbytsmpwchristian, church, office, communi typresbyts, highjunior, homechurch, calendardirectionslog
(SLD : firstpresmorris.org)
Society/Religion_and_Spirituality/Christianity/Denominations/Presbyterian/Presbyterian_Church_USA/Churches/United_States/Illinois
zum Seitenanfang ↑
imgelem
imgelem
zum Seitenanfang ↑
Urban Baby
http://urbanbaby.com/
A network of resource guides, interactive communities and an online store for urban parents in the t op metropolitan cities of the world.
imgelem, general, topics, document, return, urbanbaby, itrkid, getelementbyid, parentelem, pagetrack er, anyone, parties, disney, advertise, things, because, whipped, policy, change, interactive, ctrkp refix, gajshost, parentid, function, itrkuri, netxp1, working, career, rbxcprefixed, children, destu ri, techrepublic, newuri, francisco, parents, granddaughter, results, previous, cooking, olivia, gra ndma, recipes, school, lunchbox, cookies, script, minors, obsessive, serving, guests, casserole
urbanbaby.com - rank der domain 59202 (22439 in US)
Home/Family/Babies
zum Seitenanfang ↑
GameFAQs Reviews
Chron X Reviews for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/review/196915.html
A compilation of reviews by users.
For Chron X on the PC, GameFAQs has 4 reviews.
imgelem, document, classname, playstation, return, getelementbyid, itrkid, iphone, container, gamesp ot, interactive, gamefaqs, nintendo, parentelem, platforms, beacon, content, college, review, saturn , function, genesis, password, metacritic, reviews, search, advance, dreamcast, arcade, gamecube, ad vertise, ctrkprefix, parentid, rbxcprefixed, desturi, itrkuri, newuri, netxp1, comtechrepublicthe, f mmaxprepsmetacritic, comshopper, digital, commoblogicmp3, commysimonncaasearch, phones, sports, cbsn ews, players, sitemap, comurbanbaby, comuwirewallstripzdnet
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Strategy/Turn-Based/Chron_X/Reviews_and_Previews
zum Seitenanfang ↑
GameSpot
E3 2001 Hands-OnSimsVille - PC Previews at GameSpot
http://www.gamespot.com/pc/strategy/simsville/preview_2762367.html
Includes a preview of the game as seen at E3, and screen shots.
This new game combines elements of The Sims with SimCity.
imgelem, document, simsville, gamespot, function, buildings, return, stations, getelementbyid, scrip t, previews, structures, skills, images, itrkid, parentelem, andreas, onsimsville, simcity, business , interactive, connect, different, location, facebook, scroll, across, entertainment, rbxcprefixed, stories, netxp1, actually, cbsinteractive, sports, cbsnews, cbssports, shopping, public, appendchild , ctrkprefix, police, typical, beacon, friends, current, really, within, construct, information, cur rently, newuri
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Simulation/God_Games/Sim_Games/SimsVille/Reviews_and_Previews
zum Seitenanfang ↑
Chowhound
Austin - Chowhound
http://chowhound.chow.com/boards/61
Forum where you can ask questions and get answers about dining in Austin.
Tips for Dining, Eating, and Food Shopping in Austin, TX
austin, imgelem, document, general, recipe, scrumptiouschef, amysuehere, topics, angeles, greater, c ooking, return, boston, archive, chowhound, getelementbyid, chowhounding, luckyfatima, autocomplete, recipes, francisco, itrkid, southwest, posted, including, dishes, breakfast, england, newsletters, stories, parentelem, interactive, atlantic, brunch, southern, manhattan, dinner, gateway, function, addlepated, chispa, ontario, toronto, thorkel, topics, addtoloc, myysharona, pagetracker, password, sidebar, canada
chow.com - rank der domain 3644 (1387 in US)
Regional/North_America/United_States/Texas/Localities/A/Austin/Business_and_Economy/Restaurants_and_Bars/Guides_and_Directories
zum Seitenanfang ↑
The Bible Condensed
The Bible Condensed
http://www.thebiblecondensed.com/
Excerpts from Genesis to Revelation in 365 daily readings with commentary.
The Bible Condensed. From Gene
bible, scripture, reading, pla
samuel, chronicles, genesis, corinthians, exodus, document, psalms, matthew, isaiah, revelation, deu teronomy, tempel, timothy, jeremiah, function, leviticus, numbers, visibility, romans, divarray, img elem, myarray, divobj2, getelementbyid, joshua, gcount, return, hebrews, kingdom, length, sermon, ju dges, explorer, nehemiah, divobj, netscape, thessalonians, proverbs, menudiv, ephesians, hungry, zec hariah, hilltop, positiony, esther, positionx, ezekiel, layers, daniel, prayer, forgive
(SLD : thebiblecondensed.com)
Society/Religion_and_Spirituality/Christianity/Bible/Reading_Plans
zum Seitenanfang ↑
Jericho Road Baptist Church
http://www.jrbc-lmcs.org/
Service schedule, statement of faith, directions, and information on La Mesa Christian School.
document, tempel, visibility, function, myarray, getelementbyid, divarray, imgelem, divobj2, gcount, return, length, netscape, divobj, explorer, menudiv, sunday, school, positiony, positionx, christia n, offsetparent, website, calendar, layers, hidden, events, prepdhtmlmenu1, getrealtop, getrealleft, sports, baptist, jericho, visible, window, service, directions, offers, prepdhtmlmenu2, tuition, ch urch, number, reminders, offsetleft, ministries, church, offsettop, zindex, school, hidemenu, settim eout
(SLD : jrbc-lmcs.org)
Regional/North_America/United_States/California/Localities/L/La_Mesa/Society_and_Culture/Religion
zum Seitenanfang ↑
GameSpot
The Sims: Hot Date Preview - PC Previews at GameSpot
http://www.gamespot.com/pc/strategy/simshotdateexpansionpack/preview_2805061.html
Preview with detailed description of gameplay, screenshots, and concept sketches.
We've got the scoop on the next add-on for The Sims straight from Maxis.
imgelem, document, gamespot, function, downtown, return, previews, script, getelementbyid, location, itrkid, cheats, reviews, images, andreas, connect, facebook, parentelem, score8, player, preview, i nteractive, cbssports, articles, expansion, cbsnews, components, meaning, designers, always, college , considering, sports, cbsinteractive, videos, features, answers, summary, comment, universe, 280506 1, stories, someone, looked, social, original, creating, restaurants, different, titles, content
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Simulation/God_Games/Sim_Games/The_Sims_Series/The_Sims/Hot_Date
zum Seitenanfang ↑
Terror Labs
Terror Labs - Welcome
http://www.terrorlabs.com
Features lab items, body parts, skeletons, masks, environmental effects, lighting, edibles, and deco r.
halloween,skeletons,skulls,skeleton,skull,gore,horror,scare,fright
tempel, document, getelementbyid, imgelem, function, divcart, offsetparent, return, browser, cartspa ce, intitem, display, terror, offsettop, gettop, offsetleft, getmousexy, getleft, season, scream, ar ound, please, 2checkout, provided, services, urchintracker, 1437449, retailer, delivery, halloween, authorized, guarantee, projects, domouseon, domouseoff, scrollleft, clientx, clienty, scrolltop, his tory, novelties, contact, welcome, skeletons, edibles, startiefix
(SLD : terrorlabs.com)
Shopping/Holidays/Halloween
zum Seitenanfang ↑
GameFAQs: Wizardry
Wizardry FAQs, Walkthroughs, and Guides for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/game/564837.html
FAQ and walkthrough.
For Wizardry on the PC, GameFAQs has 1 FAQ (game guide/walkthrough).
imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, ninten do, gamespot, interactive, parentelem, gamefaqs, platforms, college, content, parentid, itrkuri, bea con, metacritic, newuri, genesis, advance, dreamcast, gamecube, search, password, arcade, ctrkprefix , netxp1, advertise, function, rbxcprefixed, desturi, saturn, maxpreps, sports, overstock, internati onal, cbssports, speakers, solutions, cbsnews, hosting, fmmaxprepsmetacritic, sitesselect, sitebnetc bs, sportscbs, radiocbs, moblogic
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/W/Wizardry_Series/Wizardry_I_-_Proving_Grounds_of_the_Mad_Overlord
zum Seitenanfang ↑
CNET.com: Simply RSS
RSS Feeds | Home - CNET.com
http://www.cnet.com/4520-6022-5115113.html
Directory of feeds from CNET.com, ZDNet, download.com, TechRepublic, builder.com, GameSpot, and Webs hot.
imgelem, document, windows, networks, return, getelementbyid, sidedoor, itrkid, products, function, height, require, parentelem, reserves, display, popular, interactive, content, readers, reviews, inf ormation, notebooks, downloads, newuri, version, 5115113, graphic, getelement, address, localvars, s hopper, popular, directory, available, innerhtml, windowheight, uservars, ctrkprefix, netxp1, distri buting, pagevars, itrkuri, parentid, desturi, specification, rbxcprefixed, topics, phones, product, mobile, attribution
cnet.com - rank der domain 100 (49 in US)
Computers/Internet/On_the_Web/Syndication_and_Feeds/RSS/Directories
zum Seitenanfang ↑
Gonzales Baptist Temple
Gonzales Baptist Temple
http://www.gonzalesbaptisttemple.org/
Includes schedule, events calendar, directions, ministries, sermons, prayer requests, and newsletter s.
document, tempel, visibility, function, divobj2, getelementbyid, imgelem, divarray, myarray, gcount, length, return, netscape, explorer, divobj, baptist, menudiv, gonzales, layers, christian, temple, offsetparent, hidden, positionx, positiony, prepdhtmlmenu1, events, visible, getrealtop, sermons, ge trealleft, sermonsaudio, offsetleft, bluegrass, zindex, wednesdays, offsettop, southern, outlines, j anuary, window, february, distributi, rejoice, college, rogers, needed, photos, prepdhtmlmenu2, cale ndar, sundays
(SLD : gonzalesbaptisttemple.org)
Regional/North_America/United_States/Louisiana/Localities/B/Brittany
zum Seitenanfang ↑
GameFAQs - Codes and Secrets - Slayer
Slayer Cheats, Codes, and Secrets for 3DO - GameFAQs
http://www.gamefaqs.com/console/3do/code/917943.html
Collection of known cheats.
For Slayer on the 3DO, GameFAQs has 1 cheat.
imgelem, document, classname, getelementbyid, playstation, message, return, itrkid, iphone, containe r, gamefaqs, function, parentelem, metacritic, platforms, interactive, nintendo, gamespot, beacon, s ubmission, advertise, content, college, password, desturi, rbxcprefixed, arcade, gamecube, ctrkprefi x, netxp1, advance, search, dreamcast, newuri, cheats, parentid, genesis, itrkuri, saturn, radiocbs, comshopper, solutionsgamespotinternationallast, sportscbs, fmmaxprepsmetacritic, commysimonncaasear ch, comtechrepublicthe, commoblogicmp3, insidertv, comcbsnews, comurbanbaby, comchowcnetcnet
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/Rogue-like/Slayer
zum Seitenanfang ↑
GameSpot
ASC Games To Shut Down - News at GameSpot
http://www.gamespot.com/news/2000/01/06/news_2446015.html
Article on the closure of ASC Games.
Werewolf: The Apocalypse developer and publisher to close its doors this Friday.
imgelem, gamespot, document, posted, function, return, comments, script, stories, company, facebook, itrkid, getelementbyid, sports, connect, interactive, andreas, studio, showcase, location, faction, metacritic, parentelem, mysimon, 2fnews, gamespot, moneywatch, connect, fbinit, window, 2446015, ma xpreps, movietome, smartplanet, titles, insider, techrepublic, official, search, shopper, informatio n, beacon, showtime, capcom, online, cbsnews, cbssports, cbsinteractive, college, cheats, cheatsgta
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Roleplaying/World_of_Darkness_Games/Werewolf_-_The_Apocalypse
zum Seitenanfang ↑
Theatre Development Fund
TDF - Theatre Development Fund
http://www.tdf.org/
Non-profit service organization for the performing arts. Discount ticket sales, marketing strategies , novice producer training programs.
dhtmlgoodies, addsubmenuitem, servicepage, document, tooltip, getelementbyid, tooltipshadow, functio n, tempel, return, browser, checkit, imgelem, display, leftpos, rotate, indexof, shadowsize, targetx , offsetparent, navigator, useragent, border, targety, getbrowser, target, addsubmenu, bodywidth, if rame, string, tooltipmaxwidth, visibility, duration, theatre, tooltipwidth, nodetohide, nodetoshow, styleunchoose, fadeduration, visible, rotateduration, stylechosen, imgsrc, accessibility, appendchil d, firefox, getimageyfromtop, offsetleft, tolowercase, scrolltop, thestring
tdf.org - rank der domain 118174 (45596 in US)
Arts/Performing_Arts/Theatre/Organizations
zum Seitenanfang ↑
GameSpot
Ghost Recon: Desert Siege Preview - PC Previews at GameSpot
http://www.gamespot.com/pc/action/tomclancysghostreconds/preview_2855128.html
Preview and screen shots.
We take a look at the forthcoming expansion pack to Ghost Recon.
clancy, imgelem, document, gamespot, function, return, desert, splinter, script, mission, getelement byid, previews, cheats, images, reviews, rainbow, itrkid, destroy, against, parentelem, mature, cont ent, connect, missions, preview, interactive, another, facebook, location, score8, andreas, governme nt, articles, sports, college, cbssports, hiding, titles, nation, hostages, cbsinteractive, future, soldier, cbsnews, ethiopian, trucks, player, universe, starcraft, looked, because
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Shooter/T/Tom_Clancy_Games/Ghost_Recon_Series/Ghost_Recon/Desert_Siege/Reviews_and_Previews
zum Seitenanfang ↑
GameFAQs: Avernum 4
Avernum 4 Cheats, Codes, and Secrets for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/code/932021.html
Contains cheats for Avernum 4.
For Avernum 4 on the PC, GameFAQs has 11 cheat codes and secrets.
document, imgelem, classname, playstation, getelementbyid, message, return, gamespot, iphone, avernu m, itrkid, container, parentelem, gamefaqs, interactive, platforms, function, nintendo, content, cri mes, college, advertise, character, metacritic, making, desturi, newuri, genesis, itrkuri, rbxcprefi xed, ctrkprefix, saturn, netxp1, parentid, search, advance, gamecube, submission, cheats, password, beacon, arcade, dreamcast, working, hosting, speakers, clearance, sitesselect, bargains, sitebnetcbs , overstock
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/A/Avernum_Series
zum Seitenanfang ↑
Gonzales Baptist Temple
Gonzales Baptist Temple
http://www.gonzalesbaptisttemple.org/
Includes schedule, events calendar, directions, ministries, sermons, prayer requests, and newsletter s. Brittany.
document, tempel, visibility, function, getelementbyid, divobj2, imgelem, divarray, myarray, return, gcount, length, explorer, divobj, netscape, baptist, gonzales, menudiv, christian, temple, layers, offsetparent, hidden, positionx, positiony, events, prepdhtmlmenu1, getrealtop, visible, sermons, ge trealleft, offsetleft, bluegrass, southern, sermonsaudio, wednesdays, offsettop, zindex, rogers, out lines, window, february, january, distributi, rejoice, college, prepdhtmlmenu2, needed, photos, cale ndar, sundays
(SLD : gonzalesbaptisttemple.org)
Society/Religion_and_Spirituality/Christianity/Denominations/Baptist/Baptist_Groups/Independent_Baptists/Local_Churches/United_States/Louisiana
zum Seitenanfang ↑
GameSpot - The Greatest Games of All Time
The Greatest Games of All Time
http://www.gamespot.com/gamespot/features/all/greatestgames/
Bi-weekly feature of games that have been uniquely influential and defined their genre.
The Greatest Games of All Time
Marble Madness,
imgelem, gamespot, document, arcade, function, greatest, return, script, itrkid, gamespot, backgroun d, fighter, better, tentacle, because, playing, metacritic, fantasy, parentelem, connect, getelement byid, different, facebook, andreas, location, interactive, genesis, system, legend, articles, moneyw atch, maxpreps, cbssports, cbsnews, college, cbsinteractive, sports, movietome, window, fbinit, conn ect, beacon, urbanbaby, search, mysimon, shopper, showtime, insider, techrepublic, smartplanet, chea tsgta
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/News_and_Reviews/Awards
zum Seitenanfang ↑
Theatre Development Fund
TDF - Theatre Development Fund
http://www.tdf.org/
Non-profit service organization for the performing arts. Discout ticket sales, marketing strategies, novice producer training programs.
dhtmlgoodies, addsubmenuitem, servicepage, document, tooltip, getelementbyid, tooltipshadow, functio n, tempel, return, browser, checkit, display, imgelem, rotate, leftpos, shadowsize, navigator, borde r, useragent, indexof, offsetparent, targetx, targety, bodywidth, tooltipmaxwidth, visibility, ifram e, addsubmenu, string, tooltipwidth, duration, getbrowser, theatre, target, stylechosen, styleunchoo se, visible, rotateduration, nodetoshow, fadeduration, nodetohide, getrealleft, accessibility, nodet oshow, thestring, vouchers, detect, offsetleft, tooltiptxt, offsettop
tdf.org - rank der domain 118174 (45596 in US)
Regional/North_America/United_States/New_York/Localities/N/New_York_City/Manhattan/Arts_and_Entertainment/Theater
zum Seitenanfang ↑
GameFAQs: Arc the Lad
Arc the Lad FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs
http://www.gamefaqs.com/console/psx/game/572644.html
Walkthroughs and FAQs.
For Arc the Lad on the PlayStation, GameFAQs has 10 FAQs (game guides and walkthroughs).
imgelem, document, playstation, classname, return, getelementbyid, iphone, container, gamespot, itrk id, interactive, parentelem, gamefaqs, platforms, nintendo, walkthrough05, gamecube, beacon, hacking , password, college, metacritic, search, content, advance, netxp1, rbxcprefixed, desturi, genesis, s aturn, ctrkprefix, itrkuri, parentid, dreamcast, arcade, function, newuri, advertise, comchowcnetcne t, forums, comcbssports, commysimonncaasearch, comurbanbaby, insidertv, comuwirewallstripzdnet, comc bsnews, sports, comtechrepublicthe, fmmaxprepsmetacritic, solutionsgamespotinternationallast, commob logicmp3
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad
zum Seitenanfang ↑
GameFAQs: Torneko: The Last Hope
Torneko: The Last Hope Reviews for PlayStation - GameFAQs
http://www.gamefaqs.com/console/psx/review/374986.html
Reader reviews.
For Torneko: The Last Hope on the PlayStation, GameFAQs has 8 reviews.
imgelem, document, playstation, classname, return, getelementbyid, iphone, torneko, container, itrki d, gamespot, gamefaqs, interactive, platforms, parentelem, nintendo, advertise, techrepublic, metacr itic, 10gamefaqs, college, content, review, password, beacon, saturn, function, reviews, ctrkprefix, netxp1, arcade, gamecube, advance, search, dreamcast, genesis, rbxcprefixed, desturi, newuri, itrku ri, parentid, around, sitebnetcbs, previews, sportscbs, sitesselect, rankingsvisit, solutionsgamespo tinternationallast, fmmaxprepsmetacritic, movies, gameplay
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/D/Dragon_Warrior_Series/Torneko_-_The_Last_Hope/Reviews_and_Previews
zum Seitenanfang ↑
GameFAQs
Dragon Warrior VII Reviews for PlayStation - GameFAQs
http://www.gamefaqs.com/console/psx/review/197152.html
Reader reviews and a preview.
For Dragon Warrior VII on the PlayStation, GameFAQs has 42 reviews.
imgelem, document, warrior, playstation, classname, return, getelementbyid, dragon, itrkid, containe r, gamespot, 10dragon, iphone, parentelem, school, platforms, gamefaqs, nintendo, interactive, revie w, previews, metacritic, advertise, beacon, content, college, 10gamefaqs, finally, gameplay, simply, amazing, newuri, parentid, rbxcprefixed, ctrkprefix, password, itrkuri, search, dreamcast, genesis, arcade, gamecube, advance, netxp1, desturi, saturn, reviews, function, gamer6, including, resources gamespotvisit
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/D/Dragon_Warrior_Series/Dragon_Quest_VII/Reviews_and_Previews
zum Seitenanfang ↑
GameSpot: Best of E3 2000
MechWarrior 4 - PC Previews at GameSpot
http://www.gamespot.com/pc/sim/mechwarrior4vengeance/preview_2569050.html
Impressions of the game at E3 2000.
The latest build of MechWarrior 4 boasts updated graphics and complete Mech models.
mechwarrior, imgelem, document, gamespot, function, return, previews, script, getelementbyid, cheats , images, microsoft, itrkid, looked, location, reviews, combat, connect, facebook, interactive, andr eas, features, impressive, score8, mercenaries, parentelem, studio, college, sports, cbsinteractive, search, shopper, mysimon, createelement, cbssports, engine, metacritic, maxpreps, ground, articles, moneywatch, movietome, summary, cbsnews, itrkuri, review, showcase, series, development, faction, m echwarrior
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Shooter/Mecha_Combat_Simulation/MechWarrior_Series/MechWarrior_4_-_Vengeance/Reviews_and_Previews
zum Seitenanfang ↑
GameSpot
MechWarrior 3 Review for PC - GameSpot
http://www.gamespot.com/pc/sim/mechwarrior3/review.html
Review by Greg Kasavin, scoring 8.3/10: "MechWarrior 3 looks, sounds, and controls better than anyth ing else like it."
It might seem rough around the edges once in a while, but nevertheless, MechWarrior 3 is a worthy su ccessor to one of the best games of the decade.
MechWarrior 3 Review for PC, PC MechWarrior 3 Review, MechWarrior 3 Review, PC MechWarrior 3, MechWa rrior 3 for PC, MechWarrior 3 Article, MechWarrior 3 Hands On
mechwarrior, imgelem, gamespot, document, function, return, weapons, reviews, review, machine, scrip t, interactive, getelementbyid, around, powerful, cheats, missions, player, especially, everything, little, itrkid, simulation, combat, exciting, score8, andreas, combat, graphics, important, facebook , connect, campaign, cbsiadglobal, easily, action, location, predecessor, anything, attack, parentel em, because, pilots, opponents, number, battles, surrounding, enemies, against, similarly, itrkuri
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Shooter/Mecha_Combat_Simulation/MechWarrior_Series/MechWarrior_3/Reviews_and_Previews
zum Seitenanfang ↑
GameSpot
F/A-18 Review for PC - GameSpot
http://www.gamespot.com/pc/sim/fa18/review.html
Review by Bruce Geryk, [8.8/10]. "Jane's F/A-18 will hook you soon enough, and once it does there's no turning back."
Jane's F/A-18 succeeds in being a superb flight simulator without being truly exceptional in any spe cific area.
F/A-18 Review for PC, PC F/A-18 Review, F/A-18 Review, PC F/A-18, F/A-18 for PC, F/A-18 Article, F/A -18 Hands On
document, imgelem, flight, gamespot, graphics, function, campaign, return, simulation, review, getel ementbyid, detail, elements, script, because, without, specific, aircraft, carrier, itrkid, parentel em, manual, metacritic, bolter, facebook, reviews, though, gamers, connect, score8, andreas, simulat ions, terrain, functions, cockpit, missions, accurately, content, location, interactive, scripted, v ariable, around, cbsinteractive, sports, flanker, college, different, novice, drivers, scores
gamespot.com - rank der domain 618 (258 in US)
zum Seitenanfang ↑
GameSpot's Guide
GameSpot - /features/baldurs_gg/
http://www.gamespot.com/features/baldurs_gg/
Walkthrough.
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, return, contains, document, quests, itrkid, character, parentelem, locations, baldur, chara cters, monsters, comprehensive, enemies, gamespot, through, getelementbyid, deadly, detailed, availa ble, player, numerous, desturi, rbxcprefixed, ctrkprefix, itrkuri, parentid, newuri, netxp1, functio n, respective, showcase, manage, attributes, unsure, encounters, abilities, interesting, creation, p retty, development, important, description, actually, tavern, eleventh, corner, review, sheepish, lo oking, hanging
gamespot.com - rank der domain 618 (258 in US)
zum Seitenanfang ↑
GameSpot
GameSpot - /features/awards1998/
http://www.gamespot.com/features/awards1998/
Picks for the best and worst of 1998.
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, return, gamespot, document, itrkid, parentelem, released, getelementbyid, function, obsessi on, netxp1, gaming, genres, difficult, ctrkprefix, marked, desturi, parentid, itrkuri, newuri, strat egy, rbxcprefixed, diversity, recent, balanced, between, gracefully, memory, almost, simulations, pa ckaging, choosing, content, better, themselves, concerned, harder, special, awards, achievement, pro cess, excited, future, subsided, seemed, ignored, heralded, hybrids, action, playing, shooters
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/News_and_Reviews/Awards/1998
zum Seitenanfang ↑
GameFAQs
F.E.A.R. Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/920744.html
Release data and a message board.
For F.E.A.R. on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, software, getelementbyid, itrkid, iphone, contain er, gamespot, parentelem, interactive, platforms, capture, games10, nintendo, gamefaqs, credits, pre views, director, college, content, advertise, metacritic, person, shooter, action, review, submissio n, arcade, netxp1, gamecube, advance, itrkuri, parentid, dreamcast, desturi, genesis, newuri, ctrkpr efix, rbxcprefixed, beacon, saturn, password, release, function, search, rankingsvisit, rankings, ga meplay
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Shooter/F/F.E.A.R.
zum Seitenanfang ↑
GameFAQs
Robots Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/924608.html
Information and a message board.
For Robots on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, itrkid, gamesntr, container, ipho ne, additional, robots, parentelem, gamefaqs, metacritic, platforms, interactive, nintendo, gamespot , submission, design, credits, advertise, arbp03, content, college, beacon, adventure, action, netxp 1, arcade, dreamcast, ctrkprefix, desturi, advance, parentid, newuri, gamecube, saturn, genesis, fun ction, itrkuri, rbxcprefixed, search, password, players, something, gamerankings, movietome, sitemap , phones
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action-Adventure/R/Robots
zum Seitenanfang ↑
GameFAQs
Hellfire FAQs, Walkthroughs, and Guides for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/game/47583.html
A selection of walkthroughs.
For Hellfire on the PC, GameFAQs has 4 FAQs (game guides and walkthroughs).
imgelem, document, playstation, classname, return, getelementbyid, itrkid, gamespot, container, ipho ne, hellfire, gamefaqs, nintendo, interactive, platforms, parentelem, itrkuri, college, content, bea con, advertise, metacritic, parentid, saturn, password, search, genesis, netxp1, function, arcade, d esturi, gamecube, advance, newuri, rbxcprefixed, dreamcast, ctrkprefix, comurbanbaby, insidertv, spe akers, comtechrepublicthe, forgot, commysimonncaasearch, comshopper, players, hosting, comuwirewalls tripzdnet, solutions, international, cbssports, commoblogicmp3
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/D/Diablo_Series/Diablo/Hellfire
zum Seitenanfang ↑
GameFAQs
Pac-Pix Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/920755.html
Data, FAQs, reviews, and a message board.
For Pac-Pix on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, pixnamcontr, interactive, parentelem, platforms, nintendo, gamefaqs, gamecube, metacritic, submi ssion, advance, advertise, search, function, college, content, password, miscellaneous, arcade, cred its, previews, desturi, beacon, newuri, genesis, itrkuri, parentid, netxp1, ctrkprefix, saturn, rbxc prefixed, dreamcast, hosting, clearance, overstock, speakers, phones, digital, cameras, laptops, ran kingsvisit, bargains
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/P/Pac-Man_Games/Pac-Pix
zum Seitenanfang ↑
GameFAQs: Master of Magic
Master of Magic FAQs, Walkthroughs, and Guides for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/game/564960.html
An FAQ.
For Master of Magic on the PC, GameFAQs has 1 FAQ (game guide/walkthrough).
imgelem, document, classname, playstation, return, getelementbyid, itrkid, iphone, container, gamesp ot, nintendo, interactive, parentelem, gamefaqs, platforms, newuri, itrkuri, college, beacon, conten t, parentid, metacritic, advertise, dreamcast, search, advance, gamecube, genesis, saturn, function, netxp1, ctrkprefix, rbxcprefixed, desturi, password, arcade, sports, cbsnews, cbssports, internatio nal, moblogic, mysimon, shopper, maxpreps, solutions, comuwirewallstripzdnet, commoblogicmp3, guides , sitesselect, sitebnetcbs, bargains
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Strategy/Turn-Based/Master_of_Magic
zum Seitenanfang ↑
GameFAQs: Arc the Lad II
Arc the Lad II FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs
http://www.gamefaqs.com/console/psx/game/572645.html
Provides numerous walkthroughs and faqs.
For Arc the Lad II on the PlayStation, GameFAQs has 19 FAQs (game guides and walkthroughs).
imgelem, document, playstation, classname, return, getelementbyid, container, iphone, itrkid, ninten do, gamespot, interactive, gamefaqs, platforms, parentelem, metacritic, beacon, college, content, wa lkthrough06, advertise, saturn, function, ctrkprefix, netxp1, gamecube, advance, search, password, a rcade, genesis, dreamcast, rbxcprefixed, itrkuri, newuri, parentid, desturi, bargains, solutionsgame spotinternationallast, overstock, speakers, hosting, rankingsvisit, clearance, comcbsnews, radiocbs, comcbssports, comchowcnetcnet, sportscbs, sitesselect, sitebnetcbs
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad_II
zum Seitenanfang ↑
TV.com: Christopher Khayman Lee
Christopher Khayman Lee on TV.com
http://www.tv.com/christopher-khayman-lee/person/18209/summary.html
Filmography and biographical information.
Christopher Khayman Lee, , photos, videos, life, biography, career, credits
imgelem, document, return, itrkid, videos, getelementbyid, background, khayman, parentelem, christop her, ctrkprefix, rbxcprefixed, parentid, newuri, desturi, features, itrkuri, function, height, heade r, photos, people, position, netxp1, adinfo, fbhost, connect, quotes, awards, category, trivia, epis odes, winners, nominations, reviews, remove, favorites, dispatches, writers, search, credits, append child, domino, createelement, features, encodeuricomponent, overview, images, lights, sucked, admitt ed
tv.com - rank der domain 1765 (712 in US)
Arts/People/L/Lee,_Christopher_Khayman
zum Seitenanfang ↑
Microsoft Plans Toilets With Web Access
http://news.cnet.com/2100-1041_3-999509.html
Article reporting that Microsoft is developing public toilets with Internet access. [Contains fictit ious information]
microsoft, imgelem, portable, comment, display, internet, iphone, access, return, dropdown, comments , whittingham, siteid, toilet, document, function, jlogger, rental, pagevars, recent, address, eleme nt, plasma, popular, security, wireless, 999509, itrkid, headlines, cancel, summer, keyboard, market , portable, hotmail, content, report, height, another, posting, personal, offensive, software, inter active, festival, windows, subscribers, comment, parentelem, posted, direct
cnet.com - rank der domain 100 (49 in US)
Reference/Education/Instructional_Technology/Evaluation/Web_Site_Evaluation/Hoax_Sites
zum Seitenanfang ↑
Engine Settings FAQ
F-Zero X FAQs, Walkthroughs, and Guides for Nintendo 64 - GameFAQs
http://www.gamefaqs.com/console/n64/game/197414.html
Walkthrough and FAQs.
For F-Zero X on the Nintendo 64, GameFAQs has 10 FAQs (game guides and walkthroughs).
imgelem, document, classname, playstation, return, nintendo, getelementbyid, itrkid, container, ipho ne, interactive, platforms, gamespot, parentelem, gamefaqs, beacon, itrkuri, advertise, college, met acritic, content, saturn, password, function, netxp1, dreamcast, arcade, gamecube, advance, genesis, search, ctrkprefix, rbxcprefixed, desturi, parentid, newuri, bargains, comshopper, clearance, hosti ng, comtechrepublicthe, overstock, sitesselect, sitebnetcbs, commoblogicmp3, commysimonncaasearch, c omchowcnetcnet, solutionsgamespotinternationallast, comcbssports, comcbsnews, speakers
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Driving_and_Racing/Racing/F-Zero_Series/F-Zero_X
zum Seitenanfang ↑
First Impression: The Sims Online
First ImpressionThe Sims Online - PC Previews at GameSpot
http://www.gamespot.com/pc/rpg/simsonline/preview_2762518.html
Preview from Gamespot on game. Reveals more on gameplay and also comments on graphics and difference s from The Sims.
Find out what you can expect from the new online game based on The Sims.
online, imgelem, document, gamespot, function, players, return, script, previews, getelementbyid, be come, online, cheats, itrkid, reviews, images, personality, within, entire, interactive, features, p arentelem, different, player, richest, impressionthe, andreas, office, device, operate, facebook, lo cation, connect, faction, famous, friends, 360wiips3ps2pspdsiphonemobileforumsvideoscheatsnew, score 6, configure, captain, eggplant, comment, possible, interaction, course, various, titles, window, 27 62518, hearts, portion
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Simulation/God_Games/Sim_Games/The_Sims_Series/The_Sims_Online
zum Seitenanfang ↑
TV.com: Brooke Nevin
Brooke Nevin on TV.com
http://www.tv.com/brooke-nevin/person/68940/summary.html
Filmography and biographical information.
Brooke Nevin, , photos, videos, life, biography, career, credits
imgelem, document, return, itrkid, videos, getelementbyid, brooke, background, parentelem, netxp1, c trkprefix, features, rbxcprefixed, newuri, adinfo, height, people, photos, header, position, functio n, desturi, connect, fbhost, itrkuri, parentid, nominations, quotes, winners, trivia, awards, catego ry, reviews, dispatches, favorites, features, remove, writers, episodes, overview, appendchild, mysi mon, images, encodeuricomponent, special, createelement, credits, search, lights, summer, caused
tv.com - rank der domain 1765 (712 in US)
Arts/People/N/Nevin,_Brooke
zum Seitenanfang ↑
Chowhound.com
Manhattan - Chowhound
http://www.chowhound.com/boards/18
For those who live to eat. Non-commercial message board and information on great eating, hosted by r estaurant critic Jim Leff.
Tips for Dining, Eating, and Food Shopping in Manhattan
manhattan, imgelem, document, recipe, general, uwsister, chowhound, restaurant, cooking, greater, an geles, return, archive, topics, boston, getelementbyid, daffyduck, england, francisco, atjsfo, chowh ounding, broadway, kathryn, newsletters, recipes, itrkid, houston, stories, summer, posted, nooyawka , autocomplete, scoopg, chowsue, recommendations, international, function, washington, obsessives, c entral, america, photos, plumpdumpling, supertaster, baltimore, parentelem, foodell, southwest, cana da, including, davina
chowhound.com - rank der domain 358401 (142022 in US)
Regional/North_America/United_States/New_York/Localities/N/New_York_City/Manhattan/Business_and_Economy/Restaurants_and_Bars/Guides_and_Directories
zum Seitenanfang ↑
GameSpot
GameSpot - /features/roguespear_pre/
http://www.gamespot.com/features/roguespear_pre/
Preview with screen shots.
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, rainbow, return, document, schnurr, itrkid, parentelem, getelementbyid, because, gamespot, changes, success, release, requests, gamers, microsoft, netxp1, desturi, function, parentid, newuri, grenades, ctrkprefix, action, retail, itrkuri, enlarge, become, rbxcprefixed, software, numbers, ch ange, realism, unturned, especially, expecting, legions, sequel, enhance, series, relative, producer , publisher, newcomer, overarching, entertainment, spirit, realistic, either, things, technology
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Shooter/T/Tom_Clancy_Games/Rainbow_Six_Series/Rogue_Spear/Reviews_and_Previews
zum Seitenanfang ↑
GameSpot
PAX '07: Day 1 wrap-up - News at GameSpot
http://www.gamespot.com/news/6177617.html
Ricardo Torres gives a wrap-up of day one of the 2007 expo.
The comic-strip-inspired gaming festival kicks off in Seattle for the fourth time, drawing a record crowd.
posted, comment, disagree, imgelem, document, gamespot, nintendo, function, gaming, festival, return , comments, metroid, attendees, actually, script, seattle, interactive, exhibitors, itrkid, brother, stories, facebook, getelementbyid, rowleyfan3000, coverage, impressive, playable, godzilla, gamers, convention, tabletop, fantasy, because, content, believe, bigger, gamespot, sports, started, relate d, andreas, public, showed, corruption, original, before, connect, metacritic, parentelem, location
gamespot.com - rank der domain 618 (258 in US)
Games/Conventions/Penny_Arcade_Expo
zum Seitenanfang ↑
GameFaqs
BloodRayne Cheats, Codes, and Secrets for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/code/542017.html
Includes cheat codes and walkthroughs.
For BloodRayne on the PC, GameFAQs has 10 cheat codes and secrets.
document, imgelem, classname, getelementbyid, playstation, return, message, itrkid, bloodrayne, cont ainer, iphone, gamespot, parentelem, interactive, gamefaqs, nintendo, platforms, function, content, submission, advertise, previews, metacritic, college, cheats, advance, gamecube, itrkuri, parentid, saturn, rbxcprefixed, desturi, newuri, search, password, netxp1, arcade, ctrkprefix, dreamcast, gene sis, beacon, clearance, location, bargains, window, reviews, sitebnetcbs, rankings, comcbssports, ra nkingsvisit, download
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action-Adventure/Survival_Horror/BloodRayne_Series/BloodRayne
zum Seitenanfang ↑
GameFAQs
Exit Release Information for PSP - GameFAQs
http://www.gamefaqs.com/portable/psp/data/929800.html
Release data and a message board.
For Exit on the PSP, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, iphone, layout, container, itrkid , interactive, parentelem, nintendo, platforms, gamefaqs, gamespot, genesis, college, designerhirosh i, advertise, abestage, designertomohito, metacritic, software, previews, corporationuljm, miscellan eous, effects, content, submission, itrkuri, beacon, saturn, gamecube, advance, search, arcade, pass word, dreamcast, function, designertohru, newuri, parentid, credits, netxp1, desturi, ctrkprefix, rb xcprefixed, mobile, around, cameras
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Puzzle/Exit
zum Seitenanfang ↑
GameFAQs
Meteos Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/922233.html
Contains information and a message board.
For Meteos on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, itrkid, container, iphone, meteos , gamespot, gamefaqs, parentelem, platforms, nintendo, interactive, beacon, techrepublic, college, s ubmission, review, previews, metacritic, advertise, miscellaneous, content, credits, gamecube, paren tid, search, ctrkprefix, advance, arcade, dreamcast, desturi, rbxcprefixed, netxp1, genesis, newuri, itrkuri, function, saturn, password, bargains, fmmaxprepsmetacritic, solutionsgamespotinternational last, clearance, comchowcnetcnet, comcbsnews, sitesselect, sportscbs
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Puzzle/Meteos
zum Seitenanfang ↑
GameSpot
X-COM: Apocalypse Review for PC - GameSpot
http://www.gamespot.com/pc/strategy/xcomapocalypse/review.html
Review by Ron Dulin, [8.6] "This is almost the X-COM sequel that folks have been hoping for."
This is almost the X-COM sequel that folks have been hoping for.
X-COM: Apocalypse Review for PC, PC X-COM: Apocalypse Review, X-COM: Apocalypse Review, PC X-COM: Ap ocalypse, X-COM: Apocalypse for PC, X-COM: Apocalypse Article, X-COM: Apocalypse Hands On
apocalypse, imgelem, document, gamespot, combat, function, review, reviews, return, agents, geteleme ntbyid, script, player, itrkid, single, technology, instead, previous, equipment, cheats, connect, f acebook, score8, buildings, interactive, parentelem, primus, aliens, andreas, content, terror, reall y, almost, location, missions, interesting, interceptor, streets, between, summary, species, sports, college, reserved, showcase, cbsnews, cbsinteractive, researches, continue, studio, universe
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Strategy/Turn-Based/X-COM_Series/Apocalypse
zum Seitenanfang ↑
GameFAQs
Electroplankton Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/926613.html
Provides data, and a message board.
For Electroplankton on the DS, the GameFAQs information page shows all known release data and credit s.
imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, gamespot, contain er, electroplankton, interactive, parentelem, nintendo, platforms, gamefaqs, metacritic, advance, ga mecube, review, beacon, submission, college, content, password, search, credits, advertise, itrkuri, parentid, previews, genesis, rbxcprefixed, newuri, desturi, dreamcast, netxp1, function, saturn, ar cade, ctrkprefix, hosting, overstock, clearance, information, comchowcnetcnet, comcbssports, comcbsn ews, solutionsgamespotinternationallast, fmmaxprepsmetacritic, commysimonncaasearch
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Music_and_Dance/Electroplankton
zum Seitenanfang ↑
GameFAQs
Age of Empires III Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/925735.html
Release data and a message board.
For Age of Empires III on the PC, the GameFAQs information page shows all known release data and cre dits.
imgelem, document, classname, playstation, return, empires, getelementbyid, itrkid, container, iphon e, parentelem, iiimicrosoft, platforms, netxp1, ctrkprefix, studiosx11, itrkuri, parentid, desturi, newuri, rbxcprefixed, advance, 05usage, gamecube, arcade, strategy, gamefaqs, password, dreamcast, n intendo, function, saturn, genesis, idrelease, better, online, dateregionage, datatitlecompanyproduc t, playrelease, rating, studiosesrb, tsystem, ensemble, historicdeveloper, datagenre, requirements, required, headphones, speakers, dorenartdon, pricestitle
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Strategy/Real-Time/Age_of_Empires_Series/Age_of_Empires_III
zum Seitenanfang ↑
GameSpot
RollerCoaster Tycoon 3 Preview - PC Previews at GameSpot
http://www.gamespot.com/pc/strategy/rollercoastertycoon3/preview_6092089.html
Preview by Jason Ocampo, includes screenshots.
The third game in the blockbuster theme park-building franchise is going 3D and will even let you ri de the coasters.
rollercoaster, tycoon, document, imgelem, gamespot, coasters, function, return, braben, roller, look ed, amusements, engine, script, previews, getelementbyid, graphics, visitors, interface, reviews, ch eats, images, itrkid, developer, design, frontier, expansion, sequel, series, working, location, dif ferent, gameplay, content, rsaquo, prices, everyone, player, connect, facebook, interactive, andreas , features, feature, differently, window, according, provide, parentelem, metacritic, preview
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Simulation/God_Games/Tycoon_Games/RollerCoaster_Tycoon_Series/RollerCoaster_Tycoon_3/Reviews_and_Previews
zum Seitenanfang ↑
CNET.com: DRM this, Sony!
DRM this, Sony! - CNET.com
http://www.cnet.com/4520-6033_1-6376177.html
Article by Molly Woods covering background and editorial options.
The Buzz Report
Molly Wood, Buzz, Daily Buzz, AnchorDesk
imgelem, document, technology, because, return, getelementbyid, digital, function, software, sidedoo r, weekly, november, products, height, itrkid, backdoor, phones, display, uninstall, trojan, compani es, notebooks, anchordesk, little, parentelem, window, piracy, rights, computer, illegal, remove, te levisions, windowheight, consumers, country, almighty, getelement, talkback, 6376177, technology, pa gevars, management, localvars, discovered, whatever, restrictions, leaves, itself, players, beginnin g, increasingly
cnet.com - rank der domain 100 (49 in US)
Society/Issues/Intellectual_Property/Digital_Rights_Management/Sony
zum Seitenanfang ↑
GameSpot
GameSpot - /features/freespace2_pre/
http://www.gamespot.com/features/freespace2_pre/
Preview
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, return, document, itrkid, freespace, parentelem, volition, compelling, gamespot, descent, g etelementbyid, original, function, rbxcprefixed, action, innovations, elements, ctrkprefix, parentid , netxp1, itrkuri, desturi, newuri, freespace, destroying, models, without, simple, involving, lates t, exclusive, mysterious, graphics, believable, taking, creating, wingmen, sophisticated, commanding , opposed, interface, excellent, stunning, images, competition, features, solitary, seeming, dogfigh ts, exacerbated, already
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Shooter/D/Descent_Series/FreeSpace_2/Reviews_and_Previews
zum Seitenanfang ↑
GameFAQs: Revenant
Revenant FAQs, Walkthroughs, and Guides for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/game/139180.html
Walkthroughs and user reviews.
For Revenant on the PC, GameFAQs has 3 FAQs (game guides and walkthroughs).
imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, revenant, gamespo t, container, gamefaqs, parentelem, nintendo, interactive, platforms, itrkuri, beacon, previews, met acritic, college, parentid, content, saturn, faqsfaq, function, search, gamecube, advance, arcade, d reamcast, genesis, rbxcprefixed, ctrkprefix, advertise, password, desturi, netxp1, newuri, comuwirew allstripzdnet, sports, solutionsgamespotinternationallast, cbssports, comtechrepublicthe, comshopper , commoblogicmp3, fmmaxprepsmetacritic, comurbanbaby, commysimonncaasearch, insidertv, cbsnews
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/R/Revenant/Cheats_and_Hints
zum Seitenanfang ↑
GameFAQs
Zapper FAQs, Walkthroughs, and Guides for PlayStation 2 - GameFAQs
http://www.gamefaqs.com/console/ps2/game/561610.html
Contains PlayStation 2 walkthrough, with details of bonus stages.
For Zapper on the PlayStation 2, GameFAQs has 1 FAQ (game guide/walkthrough).
imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, zapper , interactive, nintendo, parentelem, gamespot, gamefaqs, platforms, itrkuri, newuri, college, conten t, beacon, parentid, advance, password, function, saturn, search, metacritic, genesis, desturi, rbxc prefixed, ctrkprefix, advertise, gamecube, arcade, dreamcast, netxp1, commysimonncaasearch, comshopp er, comtechrepublicthe, players, cbsnews, cbssports, solutions, international, sports, insidertv, co mmoblogicmp3, comurbanbaby, comuwirewallstripzdnet, comcbsnews
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/Z/Zapper
zum Seitenanfang ↑
GameFAQs
Far Cry Vengeance Release Information for Wii - GameFAQs
http://www.gamefaqs.com/console/wii/data/934754.html
Cheats, reviews, and a message board.
For Far Cry Vengeance on the Wii, the GameFAQs information page shows all known release data and cre dits.
imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, vengea nce, gamespot, parentelem, vengeanceubisoftrvl, gamefaqs, interactive, platforms, nintendo, beacon, techrepublic, submission, college, person, shooter, content, credits, action, advertise, netxp1, fun ction, genesis, advance, search, metacritic, password, gamecube, dreamcast, arcade, ctrkprefix, satu rn, itrkuri, parentid, newuri, rbxcprefixed, desturi, gamerankings, comchowcnetcnet, comcbssports, p layers, forums, comshopper, mobile
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Shooter/F/Far_Cry_Series/Far_Cry_Vengeance
zum Seitenanfang ↑
GameFAQs
Time Ace Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/938139.html
FAQs, reviews, and a message board.
For Time Ace on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, container, parent elem, gamespot, interactive, gamefaqs, nintendo, platforms, insider, beacon, credits, submission, si mulation, content, futuristic, rbxcprefixed, advertise, saturn, function, metacritic, dreamcast, gen esis, password, newuri, parentid, search, itrkuri, release, desturi, gamecube, advance, netxp1, coll ege, ctrkprefix, arcade, comtechrepublicthe, sportscbs, comurbanbaby, insidertv, comshopper, radiocb s, commoblogicmp3, fmmaxprepsmetacritic, commysimonncaasearch
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Simulation/Flight/Time_Ace
zum Seitenanfang ↑
CNet Mac OS Forum
Mac OS X Forum and Discussion - CNET Forums
http://forums.cnet.com/5204-6126_102-0.html?forumID=10
Macintosh technical support forum.
Read Mac OS X discussions and get tips and advice on this topic and others on CNET Forums.
document, forums, forumsearchheader, imgelem, forums, windows, function, return, margin, leopard, fo rumid, forumid, troubleshooting, macfixit, community, selection, forumsearchform, forumidinputelemen t, universalsearch, height, display, discussions, computer, hardware, itrkid, pagenumberbottom, soft ware, search, topics, popular, select, thread, interactive, search, pagenumbertop, showing, reviews, numoftotal, parentelem, moderators, getelementbyid, gamespot, mysimon, general, please, mrmacfixit, innerhtml, decoration, ffffff, pagevars, downloads
cnet.com - rank der domain 100 (49 in US)
Computers/Software/Operating_Systems/Mac_OS
zum Seitenanfang ↑
GameFAQs: Theme Park
Theme Park Reviews for PlayStation - GameFAQs
http://www.gamefaqs.com/console/psx/review/573894.html
Offers reader reviews for the PlayStation version.
For Theme Park on the PlayStation, GameFAQs has 7 reviews.
imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, gamesp ot, platforms, interactive, parentelem, nintendo, gamefaqs, beacon, content, rollercoaster, metacrit ic, advertise, college, netxp1, function, password, arcade, ctrkprefix, genesis, desturi, dreamcast, itrkuri, saturn, advance, parentid, newuri, reviews, gamecube, search, rbxcprefixed, radiocbs, comm oblogicmp3, fmmaxprepsmetacritic, commysimonncaasearch, comshopper, comtechrepublicthe, solutionsgam espotinternationallast, comchowcnetcnet, sitebnetcbs, sportscbs, comcbsnews, comcbssports, sitessele ct
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Simulation/God_Games/Theme_Games/Theme_Park_Series
zum Seitenanfang ↑
GameFAQs: Arc the Lad III
Arc the Lad III FAQs, Walkthroughs, and Guides for PlayStation - GameFAQs
http://www.gamefaqs.com/console/psx/game/576155.html
Includes walkthroughs and frequently asked questions.
For Arc the Lad III on the PlayStation, GameFAQs has 18 FAQs (game guides and walkthroughs).
imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, container, parent elem, gamespot, platforms, gamefaqs, interactive, nintendo, beacon, content, metacritic, walkthrough 12, advertise, college, saturn, function, genesis, advance, search, password, gamecube, dreamcast, a rcade, netxp1, parentid, desturi, rbxcprefixed, ctrkprefix, itrkuri, newuri, sitebnetcbs, previews, reviews, sitesselect, bargains, comcbsnews, solutionsgamespotinternationallast, fmmaxprepsmetacritic , commoblogicmp3, resourcesgame, rankingsvisit, radiocbs, rankings, comcbssports
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/A/Arc_the_Lad_Series/Arc_the_Lad_III
zum Seitenanfang ↑
GameFAQs
Bomberman Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/920766.html
Offers information and a message board.
For Bomberman on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, container, bomber man, gamespot, interactive, platforms, nintendo, parentelem, gamefaqs, metacritic, content, college, abmp07, credits, hudson, previews, miscellaneous, advertise, password, beacon, function, netxp1, ct rkprefix, gamecube, saturn, genesis, dreamcast, arcade, search, advance, submission, parentid, itrku ri, desturi, newuri, rbxcprefixed, comchowcnetcnet, comcbssports, speakers, radiocbs, laptops, camer as, sportscbs, sitebnetcbs
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/B/Bomberman_Series/Bomberman_DS
zum Seitenanfang ↑
GameFAQs
Break 'Em All Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/932722.html
Release data and a message board.
For Break 'Em All on the DS, the GameFAQs information page shows all known release data and cre dits.
imgelem, document, playstation, classname, return, getelementbyid, gamespot, itrkid, container, ipho ne, interactive, parentelem, nintendo, platforms, gamefaqs, submission, content, advertise, advance, saturn, beacon, credits, search, password, action, college, gamecube, netxp1, dreamcast, rbxcprefix ed, ctrkprefix, genesis, desturi, arcade, metacritic, itrkuri, function, newuri, parentid, insidertv , sitesselect, radiocbs, comshopper, solutionsgamespotinternationallast, fmmaxprepsmetacritic, commy simonncaasearch, comtechrepublicthe, comchowcnetcnet, sportscbs, commoblogicmp3, comcbsnews
gamefaqs.com - rank der domain 913 (391 in US)
zum Seitenanfang ↑
GameSpot
Bomberman Land Hands-On - Wii Previews at GameSpot
http://www.gamespot.com/wii/action/bombermanland/news.html?sid=6183461&mode=recent
Preview, by Justin Calvert: "While we're not nearly as excited for the story mode as we are for the old-school battles, we did manage to have some fun along the way."
We spend some quality time with a near-finished US version of Bomberman's first Wii adventure.
bomberman, posted, comment, disagree, imgelem, document, online, minigames, bomberman, gamespot, fun ction, return, review, script, hudson, version, without, battle, previews, getelementbyid, because, itrkid, rsaquo, minigame, looked, different, everyone, simply, images, nintendo, graphics, content, reviews, cheats, people, around, hudson, enjoyed, another, everyone, interactive, button, players, b etter, reason, playing, latest, hunter, message, deleted, request
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Action/B/Bomberman_Series/Bomberman_Land
zum Seitenanfang ↑
GameFAQs
Polarium Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/925392.html
Contains release data and a message board.
For Polarium on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, iphone, gamespot, itrkid, contain er, polarium, interactive, graphic, parentelem, nintendo, platforms, gamefaqs, credits, submission, previews, content, designshoichi, american, programmingakihiro, kumagaimain, koikesound, advertise, designmikako, asnp03, college, metacritic, designdaisuke, miscellaneous, dreamcast, arcade, genesis, newuri, parentid, search, advance, netxp1, desturi, rbxcprefixed, ctrkprefix, function, saturn, itr kuri, gamecube, beacon, password, laptops
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Puzzle/Polarium
zum Seitenanfang ↑
GameFAQs
Seed Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/931232.html
Release data and a message board.
For Seed on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, container, itrkid, iphone, intera ctive, parentelem, gamefaqs, nintendo, gamespot, platforms, beacon, advertise, college, content, met acritic, submission, massively, playing, multiplayer, online, netxp1, arcade, dreamcast, gamecube, c trkprefix, search, advance, desturi, genesis, saturn, function, newuri, rbxcprefixed, password, itrk uri, parentid, fmmaxprepsmetacritic, players, location, digital, phones, commoblogicmp3, commysimonn caasearch, comurbanbaby, comuwirewallstripzdnet, sports
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/Massive_Multiplayer_Online/Seed
zum Seitenanfang ↑
Gamespot
Outwars Review for PC - GameSpot
http://www.gamespot.com/pc/action/outwars/review.html
Review by Stephen Poole, scoring 7.8/10 : "It's definitely worth trying, and you might even wind up loving it."
The very things that make it unique and interesting are also the source of some of its most frustrat ing aspects.
Outwars Review for PC, PC Outwars Review, Outwars Review, PC Outwars, Outwars for PC, Outwars Articl e, Outwars Hands On
imgelem, outwars, document, gamespot, function, reviews, return, review, getelementbyid, script, jet pack, player, combat, action, though, cheats, itrkid, missions, several, interactive, things, parent elem, facebook, connect, pretty, weapons, graphics, andreas, jetpacks, location, score7, attacks, sp orts, cbssports, cbsnews, cbsinteractive, articles, because, college, platform, another, especially, looked, couple, scores, critic, attack, better, unlimited, around, medkits
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Shooter/O/Outwars
zum Seitenanfang ↑
GameFAQs
Daemonica Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/926011.html
Release data, and a message board.
For Daemonica on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, daemonica, container, itrkid, iph one, compliant, directx, parentelem, gamefaqs, gamespot, cbsiadglobal, interactive, nintendo, platfo rms, genesis, netxp1, college, arcade, gamecube, advance, person, search, content, support, adventur e, dreamcast, submission, newuri, beacon, metacritic, advertise, parentid, itrkuri, saturn, desturi, rbxcprefixed, ctrkprefix, password, function, solutionsgamespotinternationallast, fmmaxprepsmetacri tic, mobile, comchowcnetcnet, commoblogicmp3, gamerankings, comcbssports
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action-Adventure/D/Daemonica
zum Seitenanfang ↑
TV.com: Amanda Seyfried
Amanda Seyfried on TV.com
http://www.tv.com/amanda-seyfried/person/143056/summary.html
Biography, roles and appearances, and forum.
Amanda Seyfried, , photos, videos, life, biography, career, credits
imgelem, return, document, videos, itrkid, amanda, background, parentelem, getelementbyid, seyfried, parentid, newuri, itrkuri, netxp1, function, desturi, photos, people, ctrkprefix, rbxcprefixed, hea der, height, adinfo, features, position, quotes, reviews, trivia, overview, credits, lights, favorit es, remove, earrings, images, appendchild, encodeuricomponent, createelement, search, diamond, summe r, mysimon, lights, common, special, center, disabled, javascript, result, import, enabled
tv.com - rank der domain 1765 (712 in US)
Arts/Performing_Arts/Acting/Actors_and_Actresses/S/Seyfried,_Amanda
zum Seitenanfang ↑
Gamespot - Mortal Kombat Gold Interview
Mortal Kombat Gold Interview - News at GameSpot
http://www.gamespot.com/news/2450709.html
Interview with Eurocom about the game.
Discover what UK-based Eurocom is cooking up for the next coming of Mortal Kombat.
eurocom, kombat, imgelem, mortal, gamespot, document, posted, dreamcast, character, function, weapon , return, versions, arcade, allows, textures, characters, comments, second, created, number, intervi ew, script, itrkid, previous, possible, addition, facebook, geometry, stories, polygon, currently, r esolution, special, features, hardware, stages, graphical, kitana, models, graphics, gameplay, addit ional, andreas, making, provided, studio, chicago, interactive, million, implement
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Fighting/Mortal_Kombat_Series/Mortal_Kombat_Gold
zum Seitenanfang ↑
GameSpot
Tom Clancy's Rainbow Six 3: Black Arrow Preview - Xbox Previews at GameSpot
http://www.gamespot.com/xbox/action/rainbowsix3blackarrow/preview_6102365.html
Previewed by Brad Shoemaker, with screen shots and a gameplay movie.
Ding Chavez and his team will protect the free world, once again, on your Xbox this August.
rainbow, clancy, imgelem, document, original, return, getelementbyid, splinter, pretty, campaign, ga mespot, without, considerable, online, mission, through, itrkid, rsaquo, multiplayer, features, cont rol, course, parentelem, ubisoft, images, department, player, before, gamers, score8, settings, figh ting, reviews, exactly, prices, experience, biggest, addition, anyone, desturi, essentially, expansi on, should, parentid, predecessor, newuri, although, gameplay, rbxcprefixed, visual, preview
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Shooter/T/Tom_Clancy_Games/Rainbow_Six_Series/Black_Arrow/Reviews_and_Previews
zum Seitenanfang ↑
GameSpot
SoulCalibur Review for Dreamcast - GameSpot
http://www.gamespot.com/dreamcast/action/soulcalibur/review.html
Rated 10/10 by James Mielke, "state of the art."
Think state of the art.
SoulCalibur Review for Dreamcast, Dreamcast SoulCalibur Review, SoulCalibur Review, Dreamcast SoulCa libur, SoulCalibur for Dreamcast, SoulCalibur Article, SoulCalibur Hands On
imgelem, document, gamespot, soulcalibur, calibur, function, reviews, dreamcast, review, fighting, r eturn, tekken, getelementbyid, script, player, playstation, version, graphics, system, itrkid, chara cters, cheats, effects, arcade, extremely, gamespot, parentelem, content, character, location, conne ct, facebook, techrepublic, hardware, interactive, fireworks, perfect, models, spikes, example, poly gonal, looking, polygon, rendered, capcom, person, despite, weapons, articles, moneywatch, metacriti c
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Fighting/Soul_Calibur_Series/Soul_Calibur/Reviews_and_Previews
zum Seitenanfang ↑
GameSpot
NASCAR 2005: Chase for the Cup Impressions - Xbox Previews at GameSpot
http://www.gamespot.com/xbox/driving/nascarthunder2005/preview_6102792.html
Previewed by Jason Ocampo. Includes gameplay movie. [Xbox]
EA is completely overhauling its NASCAR series with its next installment. Learn all about the signif icant changes it's undergoing.
nascar, imgelem, document, return, getelementbyid, versions, driver, racing, points, itrkid, gamespo t, console, season, version, score8, behind, parentelem, images, system, someone, sports, reviews, i ntimidator, addition, changes, prices, feature, series, newuri, desturi, ctrkprefix, rbxcprefixed, p arentid, itrkuri, netxp1, player, easily, previews, impressions, modified, function, circuit, review , another, because, studio, should, comment, newman, against, rsaquo
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Driving_and_Racing/Simulations/NASCAR_Games/NASCAR_Series/NASCAR_2005_-_Chase_for_the_Cup/Reviews_and_Previews
zum Seitenanfang ↑
TV.com: Robert O. Smith
Robert O. Smith on TV.com
http://www.tv.com/robert-o-smith/person/101499/summary.html
The television reference guide includes credits for Robert O.
Robert O. Smith, , photos, videos, life, biography, career, credits
imgelem, document, return, videos, itrkid, getelementbyid, parentelem, robert, desturi, function, rb xcprefixed, ctrkprefix, parentid, newuri, itrkuri, connect, fbhost, photos, people, netxp1, awards, category, lights, winners, search, episodes, images, trivia, credits, overview, quotes, reviews, fav orites, remove, protagonists, pantless, createelement, gamefaqs, appendchild, height, encodeuricompo nent, unescape, 3cscript, static, facebook, featureloader, protocol, location, region, secure, 12792 87803
tv.com - rank der domain 1765 (712 in US)
Arts/Animation/Voice_Actors/S/Smith,_Robert_O.
zum Seitenanfang ↑
GameFAQs
Crysis Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/931665.html
Release data, and a message board.
For Crysis on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, itrkid, container, cbsiadglobal, iphone, parentelem, platforms, shooter, ctrkprefix, action, desturi, person, parentid, itrkuri, newu ri, rbxcprefixed, function, netxp1, dreamcast, genesis, gamecube, gamefaqs, password, advance, arcad e, saturn, nintendo, takeover, global, cookie, gfebforcestreaming, firstpage, detect, undefined, tak eover, typeof, msystem, gamesanswersboardcheck, ficrysishomedatafaqscheatsreviewsimagesvideosmy, pri cestitle, datagenre, crytekesrb, fideveloper, rating, requirements, gamefaqs
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Shooter/C/Crysis
zum Seitenanfang ↑
GameSpot's Circle of Blood Walkthrough
GameSpot - /features/circle/
http://www.gamespot.com/features/circle/
Complete path through game.
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, return, document, itrkid, george, parentelem, gamespot, getelementbyid, getting, through, h istory, rbxcprefixed, desturi, ctrkprefix, function, information, netxp1, french, murder, newuri, an other, itrkuri, parentid, ireland, several, locations, nevertheless, motivation, approaching, closes t, layers, puzzles, circle, conversations, canyon, flavors, investigator, branches, conversational, richer, contacts, different, determine, liberally, detailed, questions, responses, particular, topic s, affect, sources
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Adventure/Graphical_Adventures/Broken_Sword_Series/Broken_Sword_-_The_Shadow_of_the_Templars
zum Seitenanfang ↑
GameFAQs
Final Fantasy VIII Reviews for PlayStation - GameFAQs
http://www.gamefaqs.com/console/psx/review/197343.html
A collection of submitted reviews by users.
For Final Fantasy VIII on the PlayStation, GameFAQs has 113 reviews.
imgelem, document, playstation, classname, return, getelementbyid, itrkid, container, iphone, parent elem, platforms, desturi, rbxcprefixed, advance, newuri, ctrkprefix, parentid, fantasy, itrkuri, pas sword, gamefaqs, netxp1, dreamcast, nintendo, genesis, arcade, gamecube, function, saturn, gamefaqs, firstpage, jumper, cookie, domain, viiihomedatafaqscheatssavesreviewsimagesvideosmy, aganar10, squa resoft, reviewswow, detailed, console, playing, rpgfinal, pricesgamefaqs, gamesanswersboardcheck, pl atform, leader, appendchild, height, createelement, forgot, search
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/F/Final_Fantasy_Games/Final_Fantasy_VIII/Reviews_and_Previews/PlayStation
zum Seitenanfang ↑
GameFAQs: Ultima III
Ultima III: Exodus FAQs, Walkthroughs, and Guides for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/game/562659.html
Walkthrough.
For Ultima III: Exodus on the PC, GameFAQs has 8 FAQs (game guides and walkthroughs).
document, imgelem, classname, playstation, return, getelementbyid, iphone, itrkid, container, gamesp ot, interactive, parentelem, nintendo, ultima, platforms, gamefaqs, exodus, saturn, beacon, search, advance, gamecube, password, content, college, advertise, metacritic, genesis, rbxcprefixed, ctrkpre fix, function, netxp1, desturi, dreamcast, arcade, parentid, itrkuri, newuri, fmmaxprepsmetacritic, commysimonncaasearch, insidertv, commoblogicmp3, cbsnews, sports, comurbanbaby, comtechrepublicthe, comshopper, comuwirewallstripzdnet, cbssports, laptops, speakers
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/U/Ultima_Series/Ultima_III_-_Exodus
zum Seitenanfang ↑
GameFAQs
1701 A.D. Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/932832.html
Release data, and a message board.
For 1701 A.D. on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, container, iphone, itrkid, intera ctive, gamefaqs, gamespot, parentelem, platforms, nintendo, credits, designerdirk, designersebastian , college, content, advertise, metacritic, strategy, beacon, genesis, function, dreamcast, submissio n, password, release, search, arcade, gamecube, advance, saturn, ctrkprefix, itrkuri, rbxcprefixed, netxp1, desturi, parentid, newuri, hosting, overstock, gameplay, phones, digital, cameras, laptops, speakers, bargains
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Strategy/Real-Time/Anno_Series/1701
zum Seitenanfang ↑
GameFAQs
Perimeter Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/914468.html
Cheats, reviews, and a message board.
For Perimeter on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, perime ter, gamespot, nintendo, platforms, parentelem, gamefaqs, interactive, metacritic, submission, adver tise, credits, college, strategy, content, beacon, saturn, function, netxp1, advance, search, passwo rd, gamecube, arcade, genesis, dreamcast, ctrkprefix, parentid, newuri, itrkuri, previews, rbxcprefi xed, desturi, fmmaxprepsmetacritic, solutionsgamespotinternationallast, clearance, bargains, commobl ogicmp3, around, rankings, radiocbs, reviews, comcbsnews
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Strategy/Real-Time/Perimeter_Series/Perimeter
zum Seitenanfang ↑
GameSpot
GameSpot - /features/dung2_int/
http://www.gamespot.com/features/dung2_int/
Interview and screen shots.
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, return, document, gamespot, itrkid, keeper, parentelem, dungeon, better, features, geteleme ntbyid, player, original, opponent, enlarge, desturi, rbxcprefixed, newuri, itrkuri, parentid, ctrkp refix, netxp1, function, goldsworthy, another, attract, creatures, combat, underestimated, creature, another, feature, overpowers, determined, possible, playable, importantly, balancing, redesigning, multiplayer, turned, multiplayer, server, experience, central, playing, entice, angels, supply, knig hts, counteract
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/Strategy/Real-Time/Dungeon_Keeper_Series/Dungeon_Keeper_2
zum Seitenanfang ↑
GameFAQs
Crimson Skies FAQs, Walkthroughs, and Guides for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/game/914280.html
Walkthrough and codes.
For Crimson Skies on the PC, GameFAQs has 2 FAQs (game guides and walkthroughs).
imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, crimson, containe r, gamespot, interactive, parentelem, nintendo, platforms, gamefaqs, search, advance, beacon, arcade , password, gamecube, advertise, metacritic, function, previews, content, college, saturn, newuri, p arentid, rbxcprefixed, desturi, ctrkprefix, itrkuri, dreamcast, netxp1, genesis, cbssports, comcbssp orts, comchowcnetcnet, comcbsnews, sportscbs, radiocbs, cbsnews, solutionsgamespotinternationallast, commysimonncaasearch, comshopper, comtechrepublicthe, insidertv, commoblogicmp3
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Roleplaying/C/Crimson_Skies_Series/Crimson_Skies
zum Seitenanfang ↑
GameFAQs
Wii Play Release Information for Wii - GameFAQs
http://www.gamefaqs.com/console/wii/data/935589.html
FAQs, cheats, reviews, and a message board.
For Wii Play on the Wii, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, iphone, itrkid, container, ninten do, interactive, gamespot, gamefaqs, parentelem, platforms, techrepublic, submission, content, colle ge, rhap12, playnintendorvl, metacritic, wiinintendorvl, miscellaneous, system, previews, shibataui, advertise, remote, nintendorvl, itrkuri, beacon, saturn, function, genesis, password, search, advan ce, dreamcast, arcade, gamecube, parentid, newuri, credits, ctrkprefix, netxp1, rbxcprefixed, destur i, gamerankings, speakers, mobile
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/W/Wii_Play
zum Seitenanfang ↑
GameFAQs
War Rock Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/931206.html
FAQs, reviews, and a message board.
For War Rock on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, container, ninten do, gamefaqs, gamespot, interactive, platforms, parentelem, beacon, submission, action, person, shoo ter, advertise, credits, content, saturn, function, genesis, advance, search, gamecube, arcade, drea mcast, parentid, rbxcprefixed, desturi, newuri, itrkuri, college, metacritic, netxp1, ctrkprefix, pa ssword, insidertv, fmmaxprepsmetacritic, comtechrepublicthe, commoblogicmp3, radiocbs, comchowcnetcn et, comcbssports, comshopper, comcbsnews, solutionsgamespotinternationallast
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/W/War_Rock
zum Seitenanfang ↑
GameSpot
GameSpot - /features/bestworst96/
http://www.gamespot.com/features/bestworst96/
Picks for the best and worst of 1996.
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, return, document, itrkid, gamespot, parentelem, getelementbyid, gaming, winners, ctrkprefix , rbxcprefixed, function, netxp1, desturi, itrkuri, newuri, parentid, originality, effectively, inno vative, between, greater, things, technology, sequels, improvement, explosion, multiplayer, countere d, blockbuster, continued, demanded, strategy, category, surprisingly, enough, serious, section, con tenders, included, threat, victor, winner, declared, details, writers, contributing, awards, determi ne, ballots, tallied
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/News_and_Reviews/Awards/1996
zum Seitenanfang ↑
GameFAQs
SWAT 4 Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/920508.html
FAQs, cheats, reviews, and a message board.
For SWAT 4 on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, engine, playstation, classname, return, getelementbyid, iphone, itrkid, container , officer, gamespot, interactive, parentelem, platforms, gamefaqs, nintendo, content, submission, se arch, gamecube, advance, function, credits, action, entertainment04, shooter, 4sierra, person, netxp 1, metacritic, password, review, previews, advertise, parentid, saturn, itrkuri, college, ctrkprefix , desturi, rbxcprefixed, newuri, dreamcast, arcade, beacon, genesis, mobile, around, digital, moviet ome
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Adventure/Graphical_Adventures/Police_Quest_Series/SWAT_Series/SWAT_4
zum Seitenanfang ↑
GameFAQs
Heatseeker Release Information for Wii - GameFAQs
http://www.gamefaqs.com/console/wii/data/935985.html
FAQs, cheats, images, and a message board.
For Heatseeker on the Wii, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, gamespot, heatseeker, iphone, con tainer, itrkid, nintendo, parentelem, interactive, platforms, gamefaqs, beacon, simulation, credits, college, modern, content, flight, submission, previews, saturn, advertise, function, genesis, searc h, password, metacritic, advance, gamecube, dreamcast, arcade, netxp1, itrkuri, rbxcprefixed, destur i, ctrkprefix, newuri, parentid, fmmaxprepsmetacritic, commoblogicmp3, sitemap, solutionsgamespotint ernationallast, movietome, insidertv, comurbanbaby, comuwirewallstripzdnet
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Simulation/Flight/Heatseeker
zum Seitenanfang ↑
GameFAQs
Zoo Tycoon 2 Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/919850.html
Cheats, reviews, and a message board.
For Zoo Tycoon 2 on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, tycoon, classname, playstation, return, getelementbyid, iphone, container, itrkid , gamespot, 2microsoft, interactive, parentelem, nintendo, gamefaqs, platforms, advance, strategy, c ontent, metacritic, beacon, gamecube, college, submission, previews, credits, password, ctrkprefix, saturn, function, advertise, netxp1, genesis, dreamcast, itrkuri, arcade, studios11, parentid, destu ri, rbxcprefixed, newuri, search, comchowcnetcnet, movietome, solutionsgamespotinternationallast, co murbanbaby, comuwirewallstripzdnet, sports, gamerankings, comcbssports
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Simulation/God_Games/Tycoon_Games/Zoo_Tycoon_Series/Zoo_Tycoon_2
zum Seitenanfang ↑
GameSpot
GameSpot - /features/1999/
http://www.gamespot.com/features/1999/
Picks for the best and worst of 1999.
Video Games - GameSpot is the world's largest source for PC, PlayStation 2, Xbox, GameCube, PSP, DS , Wii, GBA, PS2, PS3, PlayStation 3, and Xbox 360 video game news, cheats, reviews and more!
imgelem, return, document, gamespot, itrkid, getelementbyid, difficult, parentelem, released, surpas s, newuri, excellent, ctrkprefix, function, rbxcprefixed, netxp1, itrkuri, parentid, desturi, qualit y, freespace, starcraft, matched, number, disappoint, seemed, doomed, appeared, included, unlikely, developers, fandango, readers, choice, awards, selections, presents, ballot, disagree, category, pro ved, homeworld, racing, empires, select, representative, surprise, though, selection, nascar, select ing
gamespot.com - rank der domain 618 (258 in US)
Games/Video_Games/News_and_Reviews/Awards/1999
zum Seitenanfang ↑
GameFAQs
SimCity DS Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/935403.html
Cheats, reviews, images, and a message board.
For SimCity DS on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, iphone, itrkid, artsntr, containe r, simcity, platforms, parentelem, interactive, gamefaqs, dselectronic, gamespot, nintendo, techrepu blic, strategy, college, content, beacon, advertise, submission, metacritic, building, credits, dest uri, genesis, advance, netxp1, gamecube, function, parentid, itrkuri, saturn, newuri, search, rbxcpr efixed, ctrkprefix, arcade, dreamcast, password, sitesselect, sportscbs, sitebnetcbs, comcbssports, comshopper, comtechrepublicthe, insidertv
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Simulation/God_Games/Sim_Games/SimCity_Series/SimCity_DS
zum Seitenanfang ↑
GameFAQs
Elebits Release Information for Wii - GameFAQs
http://www.gamefaqs.com/console/wii/data/933005.html
FAQs, cheats, reviews, and a message board.
For Elebits on the Wii, the GameFAQs information page shows all known release data and credits.
object, imgelem, document, classname, playstation, return, system, getelementbyid, iphone, itrkid, c ontainer, gamespot, elebits, parentelem, interactive, nintendo, platforms, gamefaqs, previews, metac ritic, submission, action, artistyukiko, eikagame, relp05, artisthiroaki, programmertakuro, suzukiop ening, programmertakeshi, artisttomohiro, content, college, artistshigeya, programmerkazuya, genesis , beacon, saturn, dreamcast, credits, password, search, advance, arcade, gamecube, function, newuri, parentid, itrkuri, advertise, desturi, rbxcprefixed
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/E/Elebits
zum Seitenanfang ↑
GameFAQs
X3: Reunion Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/927012.html
FAQs, cheats, and a message board.
For X3: Reunion on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, reunion, return, getelementbyid, iphone, container, games pot, itrkid, content, parentelem, nintendo, gamefaqs, interactive, platforms, simulation, advertise, metacritic, college, beacon, previews, programmingsebastian, credits, submission, edition, function , arcade, saturn, search, advance, newuri, dreamcast, gamecube, parentid, itrkuri, desturi, netxp1, password, genesis, rbxcprefixed, ctrkprefix, players, phones, sitebnetcbs, sportscbs, digital, sites select, laptops, clearance
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/Space_Combat/X_Series/X3_-_Reunion
zum Seitenanfang ↑
GameFAQs
Picross DS Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/936532.html
FAQs, cheats, reviews, and a message board.
For Picross DS on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, dsnintendontr, getelementbyid, picross, itrkid, i phone, container, platforms, interactive, parentelem, gamefaqs, nintendo, gamespot, beacon, credits, college, metacritic, puzzle, advertise, password, newuri, saturn, miscellaneous, genesis, gamecube, advance, arcade, dreamcast, function, desturi, rbxcprefixed, itrkuri, parentid, content, submission , search, ctrkprefix, netxp1, phones, players, sitebnetcbs, bargains, sitesselect, radiocbs, sportsc bs, clearance, laptops
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Puzzle/Picross_DS
zum Seitenanfang ↑
GameFAQs
AquaNox Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/447287.html
Provides information, help, codes, and a message board.
For AquaNox on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, aquanox, parentelem, platforms, interactive, gamefaqs, nintendo, advertise, beacon, college, sim ulation, password, futuristic, previews, submission, credits, itrkuri, saturn, function, dreamcast, arcade, genesis, desturi, newuri, metacritic, parentid, rbxcprefixed, netxp1, content, search, gamec ube, ctrkprefix, advance, comshopper, comtechrepublicthe, sitesselect, comcbsnews, comcbssports, com chowcnetcnet, solutionsgamespotinternationallast, radiocbs, fmmaxprepsmetacritic
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Action/A/AquaNox_Series/AquaNox
zum Seitenanfang ↑
GameFAQs
Red Steel Release Information for Wii - GameFAQs
http://www.gamefaqs.com/console/revolution/data/932528.html
Release data, and a message board.
For Red Steel on the Wii, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, getelementbyid, iphone, container, itrkid, steelu bisoftrvl, parentelem, gamespot, gamefaqs, interactive, platforms, nintendo, techrepublic, submissio n, advertise, metacritic, action, credits, college, redp12, content, shooter, person, beacon, search , advance, gamecube, function, netxp1, arcade, genesis, dreamcast, saturn, rbxcprefixed, ctrkprefix, review, newuri, previews, parentid, itrkuri, password, desturi, solutionsgamespotinternationallast, comcbssports, comchowcnetcnet, rankings, comcbsnews
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Shooter/R/Red_Steel
zum Seitenanfang ↑
GameFAQs
Rayman DS Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/924893.html
Data, cheats, reviews, and a message board.
For Rayman DS on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, rayman, iphone, container, itrkid , gamespot, interactive, parentelem, nintendo, gamefaqs, platforms, college, metacritic, credits, pa ssword, beacon, gamecube, action, submission, content, search, advance, dsubisoftntr, genesis, rbxcp refixed, netxp1, advertise, saturn, ctrkprefix, desturi, arcade, function, dreamcast, itrkuri, newur i, parentid, comchowcnetcnet, movietome, comcbssports, insidertv, comcbsnews, comurbanbaby, comuwire wallstripzdnet, comtechrepublicthe, gamerankings, fmmaxprepsmetacritic
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Platform/Rayman_Series/Rayman_DS
zum Seitenanfang ↑
GameFAQs
25 to Life Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/926658.html
Provides release data and a message board.
For 25 to Life on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, iphone, container, itrkid, gamesp ot, gamefaqs, interactive, platforms, nintendo, parentelem, action, shooter, advertise, college, con tent, beacon, metacritic, previews, credits, submission, person, detective, dreamcast, arcade, newur i, function, saturn, itrkuri, gamecube, advance, netxp1, search, password, ctrkprefix, desturi, rbxc prefixed, parentid, genesis, gameplay, speakers, bargains, clearance, screenshots, hosting, overstoc k, comcbsnews
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Shooter/2/25_to_Life
zum Seitenanfang ↑
GameFAQs PSP
Sticky Balls Release Information for PSP - GameFAQs
http://www.gamefaqs.com/portable/psp/data/920837.html
Data and a message board.
For Sticky Balls on the PSP, the GameFAQs information page shows all known release data and credits.
imgelem, document, playstation, classname, return, getelementbyid, itrkid, iphone, sticky, container , platforms, gamefaqs, parentelem, gamespot, nintendo, interactive, submission, gamecube, advertise, college, advance, beacon, content, miscellaneous, newuri, saturn, function, dreamcast, genesis, met acritic, desturi, rbxcprefixed, parentid, arcade, search, password, netxp1, ctrkprefix, itrkuri, sol utionsgamespotinternationallast, sports, comurbanbaby, comuwirewallstripzdnet, insidertv, comtechrep ublicthe, fmmaxprepsmetacritic, commoblogicmp3, commysimonncaasearch, comshopper, cbsnews, digital
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Puzzle/Sticky_Balls
zum Seitenanfang ↑
GameFAQs
Zoo Keeper Release Information for DS - GameFAQs
http://www.gamefaqs.com/portable/ds/data/924607.html
Contains information, FAQs, cheats, and a message board.
For Zoo Keeper on the DS, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, keeper, getelementbyid, itrkid, iphone, container , gamespot, platforms, interactive, keeperignition, gamefaqs, entertainmentntr, parentelem, nintendo , miscellaneous, advertise, college, content, beacon, metacritic, credits, azkp03, submission, passw ord, function, netxp1, newuri, parentid, desturi, rbxcprefixed, saturn, arcade, gamecube, dreamcast, genesis, advance, search, itrkuri, ctrkprefix, comscore, bargains, forgot, clearance, speakers, hos ting, overstock, sitesselect
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Puzzle/Zoo_Keeper
zum Seitenanfang ↑
GameFAQs
Spore Release Information for PC - GameFAQs
http://www.gamefaqs.com/computer/doswin/data/926714.html
Information, links, and a message board.
For Spore on the PC, the GameFAQs information page shows all known release data and credits.
imgelem, document, classname, playstation, return, games09, getelementbyid, container, itrkid, iphon e, engineer, gamefaqs, parentelem, gamespot, edition, interactive, platforms, galactic, nintendo, be acon, strategy, advertise, breeding, metacritic, credits, parentid, genesis, function, content, satu rn, dreamcast, arcade, submission, password, release, college, gamecube, advance, search, rbxcprefix ed, review, newuri, desturi, itrkuri, netxp1, previews, ctrkprefix, bargains, players, sitesselect, digital
gamefaqs.com - rank der domain 913 (391 in US)
Games/Video_Games/Simulation/God_Games/Spore
zum Seitenanfang ↑
Top Suchaufträge:

alle Kategorien

 - 

humor

 - 

auto

 - 

chat

 - 

handy

 - 

erotik

 - 

telefonbuch

 - 

job

 - 

flug

 - 

digitalkamera

 - 

lack

 - 

software

 - 

billigflug

 - 

notebooks

 - 

horoskop

Alle Rechte vorbehalten. Copyright refertus.info 2010. Für weitere Informationen lesen Sie unseren Haftungsausschluss. Webhosting