
| Datum |
rank |
rank country (Germany) |
| 2012-06-02 | 77897 | 3980 |
| 2012-06-01 | 78421 | 4013 |
| 2012-05-31 | 79387 | 4063 |
| 2012-05-30 | 79387 | 4063 |
| 2012-05-29 | 78493 | 3998 |
| 2012-05-28 | 79458 | 4069 |
| 2012-05-27 | 78864 | 4027 |
| 2012-05-26 | 75066 | 3814 |
| 2012-05-25 | 74679 | 3802 |
| 2012-05-24 | 73619 | 3716 |
| 2012-05-23 | 72866 | 3672 |
| 2012-05-22 | 71803 | 3614 |
| 2012-05-21 | 71803 | 3614 |
| 2012-05-20 | 71803 | 3614 |
| 2012-05-19 | 67980 | 3421 |
| 2012-05-18 | 68121 | 3421 |
| 2012-05-17 | 68121 | 3421 |
| 2012-05-16 | 69353 | 3493 |
| 2012-05-15 | 69353 | 3493 |
| 2012-05-14 | 68120 | 3415 |
| 2012-05-13 | 66233 | 3351 |
| 2012-05-12 | 66233 | 3351 |
| 2012-05-11 | 64526 | 3261 |
| 2012-05-10 | 65853 | 3302 |
| 2012-05-09 | 65853 | 3302 |
| 2012-05-08 | 67733 | 3392 |
| 2012-05-07 | 70036 | 3514 |
| 2012-05-06 | 70430 | 3531 |
| 2012-05-05 | 68249 | 3409 |
| 2012-05-04 | 66985 | 3347 |
| Domain wird bei folgenden keywords gefunden |
| keyword |
durchn. Position in Suchmaschinen |
keyword Popularität |
|
| Ausbildung | 266 | 120 | * |
|
| Domain |
haw-hamburg.de |
| TLD |
DE |
| Host IP |
134.28.219.3 |
| Country |
Germany |
| Reverse DNS |
haw02.rz.tu-harburg.de |
| web search |
|
| Nameserver |
deneb.dfn.de, ws-mue1.win-ip.dfn.de, dns.is.haw-hamburg.de, dns2.is.haw-hamburg.de, dns3.is.haw-hamburg.de |
| Global Rank |
74483 |
| Country Rank |
3980 |
| Popularity |
          |
| Incomming links |
21504 |
| Online since |
|
| Title |
HAW Hamburg: HAW HAMBURG |
| Description |
Hochschule f |
| Header Keywords |
|
| Content Keywords |
departments, fakult, konzentrat, elektrotechnikmaschinenbau, flugzeugbaugesundheitswissenschafteninformatikinformationinformations, managementpublic, departmentsbiotechnologiedesignfahrzeugtechnik, produktionmedientechnikmedizintechnikpflege, managementsoziale, aktuellprofilstudiumforschungweiterbildungeinrichtungenzentrale, international, bergreifender, services, maileronline, heliossitemapsraumvermietungintranetkontaktimpressumdirekt, themen, wichtigen, hibshaw, softlinksstudierendenzentrumbibliotheken, hochschul, kotrophologiewirtschaftsingenieurwesen, navigationsmen, studiengang, zentrale, arbeitumwelttechnikverfahrenstechnikwirtschaft, medien, hamburgdesign, informationlife, sciencestechnik, undsoziales, undinformatikwirtschaft, tenhaw, springen, hamburg, hamburg, naviagation, design, jahresausstellung, bilderbogen |
Banner
(->mehr banners)
|
|
% Copyright (c) 2009 by DENIC
% Version: 1.11.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/background/whois-service/webwhois.html
Domain: haw-hamburg.de
Domain-Ace: haw-hamburg.de
Nserver: dns.is.haw-hamburg.de 141.22.192.100
Nserver: dns2.is.haw-hamburg.de 141.22.192.101
Nserver: dns3.is.haw-hamburg.de 141.22.192.102
Nserver: ws-mue1.win-ip.dfn.de
Nserver: deneb.dfn.de
Status: connect
Changed: 2006-06-24T17:29:06+02:00
[Tech-C]
Type: PERSON
Name: Joerg Kottusch
Address: Hochschule fuer angewandte Wissenschaften Hamburg
Address: IT Service Center
Address: Alexanderstrasse 1
Pcode: 20099
City: Hamburg
Country: DE
Phone: +49 40 42875 8881
Fax: +49 40 42875 8889
Email: joerg.kottusch@is.haw-hamburg.de
Changed: 2009-02-12T10:40:12+01:00
[Zone-C]
Type: PERSON
Name: Joerg Kottusch
Address: Hochschule fuer angewandte Wissenschaften Hamburg
Address: IT Service Center
Address: Alexanderstrasse 1
Pcode: 20099
City: Hamburg
Country: DE
Phone: +49 40 42875 8881
Fax: +49 40 42875 8889
Email: joerg.kottusch@is.haw-hamburg.de
Changed: 2009-02-12T10:40:12+01:00
|
| Competitors (nach Besucherfluß) |
|
|
|