refertus.info Sitemap.XML / Sitemap.HTML / search / Kontakt & Impressum / Domains
refertus.info
  ordered by rank        
 
Banner Design - Animated Web Banner Maker - Banner ad Design
http://www.bannersmall.com
Animated Banner design company -Making banners from 2003- 75000 banners and 6000 clients
Professional Banner Design Service - Animated, Static web Banner,High end design,24 hour turnaround - Making Banners since 2003
animated banners,banner maker,animation banner,html banner,banner templates,animated gif banner,web banners,banner design,ad banner design,banner ad design,create banner,web banners,banner ad,banner c reation,banner designers,advertising design firm,creative ads,internet banners,animated banners,bann er creation services
decoration, margin, family, height, banner, 2b2b2b, design, weight, 344e7a, animated, active, questi ons, fontb2, visited, e4e4e4, bottom
bannersmall.com - rank der domain 245968 (94602 in US)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
Banner Design Firm
We design unique banner ads from just .95 - BannersMall.com
http://bannersmall.com/
Custom animated banners and ad design with a 48-hour delivery.
affordable pricing, professional quality, and a swift delivery service.
animated banners,banner maker,animation banner,html banner,banner templates,animated gif banner,web banners,banner design,ad banner design,banner ad design,create banner,web banners,banner ad,banner c reation,banner designers,advertising design firm,creative ads,internet banners,animated banners,bann er creation services
margin, family, decoration, height, 2b2b2b, dc2611, weight, bottom, questions, design, bannersmall, e4e4e4, fontb2, visited, banner, unique
bannersmall.com - rank der domain 245968 (94602 in US)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
banner
banner
zum Seitenanfang ↑
Hey Banner, Banner
Web banner ad design
http://heybannerbanner.com/
Animated banner ad design featuring award-winning designers and copywriters. Fast turnaround.
The Banner Guy, who designs nothing but banner ads Banner ad designer banner design web banner flash
banner ads, banner ad design, ad banners, web banner, baner, designer, internet banner, banner, desi gn, banner design, ads, flash
length, banner, folders, client, banner, 728x90, designed, design, banners, banners, random, parsein t, another, document, within, samples, iphone, request, online, animated, target, campaign, started, heybannerbanner, custom, marketing, paypal, advertising, change, reload, standard, skylight, dollar s, available, recent, button, trackable, designers, highly, discuss, specifications, requirements, m atter, formats, winner, tastefully, created, outside, advance, policy, testimonials
heybannerbanner.com - rank der domain 318182 (123021 in US)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
Media 2.0
Web banner ad design
http://www.2pt0.com/
Optimizes web sites for search engines and web directories.
The Banner Guy, who designs nothing but banner ads Banner ad designer banner design web banner flash
banner ads, banner ad design, ad banners, web banner, baner, designer, internet banner, banner, desi gn, banner design, ads, flash
length, banner, folders, client, banner, 728x90, designed, design, banners, banners, random, parsein t, another, document, within, samples, iphone, request, online, animated, target, campaign, started, heybannerbanner, custom, marketing, paypal, advertising, change, reload, standard, skylight, dollar s, available, recent, button, trackable, designers, highly, discuss, specifications, requirements, m atter, formats, winner, tastefully, created, outside, advance, policy, testimonials
(SLD : 2pt0.com)
Computers/Internet/Web_Design_and_Development/Promotion/Search_Engine_Optimization_Firms/M
zum Seitenanfang ↑
banner
banner
zum Seitenanfang ↑
Web Banner Design
Web Banner Design, Web Banners Design, and Web Banner Advertising Design by Strategic Solutions: Web Banner
http://www.ss-banners.com/
Custom design advertising banners, static, animated, or interactive. Examples provided.
Web banner design, web banners design, and web banner advertising design by Strategic Solutions, pro fessional web banner design business offering banner ad design, web banner design, banner advertisin g design, website banner design, favicon design, and favicons design services.
web banner design, web banners design, web banner advertising design, web banner, web banners, web b anner advertising, banner design, banners design, banner advertising design, banner advertising, ban ner, banners, banner ad, banner ads, custom banners, online banner, website banner, page banner, web banners, animated banner, flash banner, banner designs, website banners, online banners, web site b anner, advertising banners, animated banners, ad banners, banner ad design, internet banner advertis ing, banner graphics, banner creation, banner designer, banners ads, advertising banner ads, adverti sement banner, web page banner, banner advertisement, online banner advertising, flash banner ad, di gital banners, make web banner, web banner ads, banner advertise, internet banner ads, web site bann er advertising, banners gif, flash banner design, flash banner ads, flash web banner, web banner ad, web page banners, banner ad advertising, website banner advertising, 468x60 banner, banner designin g, banners designs, onli
design, design, banner, banner, banners, strategic, solutions, runcontent, gajshost, selectednode, d ocument, attract, consulting, offers, hosting, services, services, header, advertising, pagetracker, quality, 10612387, registration, domain, customized, development, gettracker, addition, similar, so ftware, making, attractive, trackpageview, elegant, unique, always, search, engine, business, profes sional, analytics, offering, 3cscript, unescape, google, favicons, website, favicon, sitemap, protoc ol, programming
(SLD : ss-banners.com)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
Bannerset.it
Bannerset.it - Tutto sui banner. Dimensioni standard dei banner, circuiti di scambio banner, creazione banner on line gratis.
http://www.bannerset.it/
Presenta sezioni dedicate ai banner, con informazioni sulle dimensioni standard, sulla loro utilità e un tool per crearli online.
Servizi relativi alla creazione di banner pubblicitari, circuiti di scambio banner, creazione di ban ner on line.
banner, creazione banner, creazione banner on line, tutto gratis banner, banner gratis, scambio bann er, circuiti banner, circuiti di scambio banner, dimensioni standard banner, standard iab, banner st andard
banner, banner, scambio, gratis, circuiti, creazione, dimensioni, standard, benvenuti, glossario, cr eazione, scambio, questo, bannerset, bottoni, bannerset, dimensioni, standard
bannerset.it - rank der domain 966211 (17974 in IT)
World/Italiano/Computer/Grafica
zum Seitenanfang ↑
Banner-Exchange
Banner-Exchange.ORG
http://banner-exchange.org/
Basic banner exchange. [Ratio: 3:2 Banner Sizes: 468x60]
exchange, banner, banner, credits, earning, displayed, displaying, credit, accumulated, another, mem bers, 2956248, reserved, banners, served, rights, traffic, copyright, directory, resources, exchange , design, groups, related, design, websites, discussion, signup, username, password, through
(SLD : banner-exchange.org)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Banner 4 U
Banner4U.net! Banner Creation Services = Effective Banner Ad Designs
http://www.banner4u.net/
Free banner creation service offers animated and 3D lettering in exchange for link back to site.
Banner ad design. Custom designed banner ads. Affordable, quick turnaround, great services
banner,banner creation,creating banners,banner creator,banner designer,banner designs,banner ad desi gn, banner ad designer, making banners,banners,custom banner designer,buttons created,button creator ,flash,animation,Banner,Banners,flash banner designer,animated banners
banner, banner, advertising, banner4u, bannerdesigner, creating, campaign, discounts, copyright, int ernet, creation, designs, specializes, effective, creation, services, custom, banner4u, design
(SLD : banner4u.net)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
The Gospel Banner Exchange
Banner Exchange
http://exchange.christiansunite.com/
2:1 ratio. Banner size: 468x60. You must adhere to their specified Christian creed. Exchange attache s their ad.
Free Christian Banner Exchange. Display your site's banner on other Christian Web sites across the i nternet.
Free, banner,banner exchange,advertising,christian, search engine, directory, religion, resources, f amily, God, bible
000099, normal, banner, exchange, visited, exchangemain, 990000, helvetica, family, weight
christiansunite.com - rank der domain 95485 (40314 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest/Christian
zum Seitenanfang ↑
QuickBanner
QuickBanner - Online flash banner maker and animated banner design.
http://www.quickbanner.com/
Online banner maker enables you to create, design and animate customized banners in three steps.
Online banner maker enables you to create, design and animate customized flash banners in three simp le steps.
banner maker, banner design, animated banner, flash banner, banner creator, create banner, banner s oftware, make banner, banner creation, making banner, banner generator, banner ad creation, banner d esigner, flash banner design, banner making, banner ad maker, flash banner ads, flash banner maker, flash banner generator, flash banner template, make flash banner, banner exchange, banner advertis ing, banner, flash, online, QuickBanner, www.quickbanner.com
family, verdana, decoration, document, banner, cookie, 000000, ffffff, underline, 333366, template, loginform, margin, return, templates, function, browse, length, createbanner, password, languagebar, navbar, window, endstr, quickbanner, active, visited, ffcc00, findoutmoretext, domain, expires, pad ding, member, banner, secure, offset, creator, 468x60, animated, bottom, select, choose, design, req uired, openwindow, setcookie, banners, leading, getcookieval, create, substring
quickbanner.com - rank der domain 372907 (145134 in US)
Computers/Internet/Web_Design_and_Development/Authoring/Online_Tools/Graphics/Image_Generation
zum Seitenanfang ↑
Banner promotion
SCAMBIO BANNER GRATUITO PROFESSIONALE
http://www.bannerpromotion.it/
Rapporto di esposizioni 3:2, 500 crediti omaggio all'iscrizione, possibilità di scegliere le categor ie di siti su cui visualizzare il banner, e quelle da cui accettare banner, possibilità di esporre p iù banner nelle proprie pagine.
professionale, gratuito, banner, scambio
bannerpromotion.it - rank der domain 945623 (16868 in IT)
World/Italiano/Computer/Internet/Marketing/Scambio_Banner
zum Seitenanfang ↑
Travel Banner Exchange
Travel Banner Exchange : Free travel banner exchange from ClickLeisure.com
http://www.clickleisure.com/
Banner exchange reserved exclusively for travel related websites. [Ratio: 2:1 Banner Sizes: 468x60]
Travel banner exchange. We offer a free travel banner exchange for owners of all travel sites. Our m embers enjoy huge traffic boosts, along with bonus credits and unlimited search engine submission. J oin Today!
travel banner exchange, travel banner xchange, free travel banner exchange, travel site promotion, t ravel site advertising
banner, statement, privacy, resources, exchange, travel, clickleisure, contact, information, classif ieds, submission, further, advertise, neobanners, promote, tuesday, travel, banner, exchange, accoun t, generator, address, password
clickleisure.com - rank der domain 869541 (0 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest
zum Seitenanfang ↑
Greater Banner Elk Business Association
Banner Elk
http://www.bannerelk.org/
Area accommodations, restaurants, shops, services, and real estate. Includes organization minutes, e vent notices, and live camera.
Banner Elk Chamber of Commerce features Banner Elk North Carolina, Banner Elk Sugar Mountain, Banner Elk NC real estate, Banner Elk real estate.
banner elk chamber of commerce, banner elk, banner elk north carolina, banner elk sugar mountain, ba nner elk nc real estate, banner elk real estate, banner elk nc hotel, banner elk cabin rental, banne r elk nc vacation, banner elk accommodation, banner elk web cam, banner elk nc extended weather fore cast, banner elk nc map, nc wedding, nc mountain wedding
banner, chamber, runcontent, beautiful, offers, restaurant, mountains, runactivecontent, summer, eve nts, macromedia, native, flowers, biking, hiking, trails, friendly, located, village, better, welcom es, because, environment, restaurants, moment, arrive, spring, welcome, people, guests, campus, coll ege, family, entire, picnic, relaxing, settings, natural, nature, ponder, numerous, dinner, country, attractions, something, accommodations, chamber, service, courses, business, offering
(SLD : bannerelk.org)
Regional/North_America/United_States/North_Carolina/Localities/B/Banner_Elk/Business_and_Economy
zum Seitenanfang ↑
Banner 30
Banner 30 klubben, velkommen
http://www.banner-30.dk/
Banner 30 klubben. Specialklub under Dansk Sejlunion, for bådtypen Banner 30.
normal, weight, family, padding, border, decoration, bottom, height, spacing, helvetica, tahoma, ver dana, indent, cursor, 333333, helvetica, important, nowrap, letter, injection, klubben, underline, v elkommen, repeat, margin, background, banner
(SLD : banner-30.dk)
World/Dansk/Fritid/Sejlads/Klasser
zum Seitenanfang ↑
Impronta dell'Orso
i banner
http://www.improntadellorso.it/banner.html
Analisi su come impostare e ottimizzare campagne banner online.
analisi sull'efficacia dei banner pubblicitari nell'ambito dell'online advertising
banner
(SLD : improntadellorso.it)
World/Italiano/Affari/Marketing_e_Pubblicità/Pubblicità/Agenzie
zum Seitenanfang ↑
1ha
1ha banner network
http://1ha.ad.md/
Молдавская баннерная сеть. Формат 100х100, комиссия 10%, подъемные 1000.
The 1ha banner network includes a banner exchange and offers commercial advertising services
1ha banner network hectar advertising Moldova DNT design.md
network, banner
(SLD : ad.md)
World/Russian/Компьютеры/Интернет/Дизайн_и_разработка_сайтов/Продвижение_сайтов/Баннерные_сети/Региональные
zum Seitenanfang ↑
HitExchange
HitExchange - Banner Exchange Network
http://www.hitx.net/
Trade banner click-throughs. Supports up to eight banners per account. [Ratio: 4:5 Banner Sizes: 468 x60, 400x50, 400x40]
In this banner exchange, web sites trade click-thrus at 5:4 ratio or better. And unlike other banne r exchanges, our members display banners only for fellow members.
banners, banner advertising, free banners, banner exchange, free banner exchange program, web advert ising, web promotion, banner ad, link exchanges, good banner exchange, click through, click thru
password, hitexchange, visitors, receive, participate, welcome, account, network, banner, exchange, operate, exchange, banner, advertise
hitx.net - rank der domain 973508 (422744 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Banner Ignition
Banner Ignition - Making Banner Management Easy
http://www.bannerignition.co.za
Offering banner creation and banner campaign management.
Banner Ignition - Making Banner Management Easy
website, banner, ignition, income, traffic, banner, market, making, additional, banners, advertise, listed, clicks, results, specific, measurable, existing, advertising, becoming, websites, assists, c onversions, visits, through, indicators, everything, heavenly, budget, require, quantify, success, e nabling, depend, current, invoices, prices, advertisers, statistics, loaded, generated, easily, sche duled, uploaded, giving, identify, shapes, clients, compliant, effort, nearly, through
co.za - rank der domain 10979 (27 in ZA)
Business/Marketing_and_Advertising/Internet_Marketing/Marketing_Services
zum Seitenanfang ↑
Banner Italia
Banner Italia
http://www.banneritalia.altervista.org
Scambio banner con rapporto di scambio 1:1
Banner Italia è un sistema di scambio banner molto professionale con il quale pianificare le tue cam pagne pubblicitarie, offre gratuitamente statistiche dettagliate, un rapporto di visualizzazione van taggiosissimo,possibilità di inserire uno o più banner nel sistema, i siti iscritti hanno tutti un u nico scambiobanner che aumenta notevolmente il CTR.
banner, modifica, dimensione, copyright, 60pxformato, registrazione, domini, redirect, creazione, ri ghts, reserved, banner, preleva, codice, aggiungi, registrati, italia, questo, scambio, rapporto, se rvizio, gratuito
altervista.org - rank der domain 548 (9 in IT)
World/Italiano/Computer/Internet/Marketing/Scambio_Banner
zum Seitenanfang ↑
Adendum
Banner Exchange and internet banner ad exchange.
http://adendum.com/
Can have up to four banners and multiple URLs for each banner. [Ratio: 3:2 Banner Sizes: 468x60]
Banner Exchange and internet banner ad exchange, learn how to use it.
banner exchange,advertising.
banner, banner, exchange, advertising, exchange, banners, credits, displayed, design, online, promot ion, advertising, towards, 468x60, networks, adendum, several, diagram, customers, people, detailed, choose, document, creative, become, resources, different, placement, prefer, others, combined, feat ures, directed, familiar, allows, advertise, identification, awareness, system, section, effective, design, promotional, effort, testing, facility, copyright, rather, target, information, account
adendum.com - rank der domain 977889 (423700 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Softbiz Banner Ads Management Script
BANNER ADS MANAGEMENT SCRIPT : Manage Banner Ads automatically. PHP MySQL Script
http://www.softbizscripts.com/banner-ads-management-script-features.php
Run banner ads on site with this PHP script. Advertisors buy banner impressions via paypal.
Softbiz Banner Ad Management Script automates the advertising interface of your site and 100% optimi zes its earning potential. Saves you time,effort.
Banner, Ad, Ads, Banner Ad Management, Script, PHP, Banner Management, PHP, MySQL, Script
script, script, software, banners, directory, language, banner, banner, advertisers, management, scr ipts, classifieds, through, impressions, exchange, different, display, article, auction, advertising , configure, unapproved, provide, schemes, domain, feature, extensive, delete, approved, native, gal lery, advertiser, scheme, shopping, dating, online, experience, change, parameters, administrator, c olors, settings, service, received, length, clicks, translate, strings, displayed, particular, featu res
softbizscripts.com - rank der domain 46559 (1940 in IN)
Computers/Programming/Languages/PHP/Scripts/Ad_Management
zum Seitenanfang ↑
MessiahNet Banner Exchange
MessiahNet Banner Exchange
http://banners.messiahnet.com/banner_info.htm
1:1 ratio plus 1000 credits. Banner size: 400x40. Exchange attaches their ad, to the left of your ba nner, and a text link below. For Messianic and Christian ministries who support and encourage Jewish believers in the Messiah. Must adhere to a statement of faith.
exchange, banner, messiahnet
(SLD : messiahnet.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest/Christian
zum Seitenanfang ↑
Cordelia Loew - Banner und Fahnen
http://www.loewe-banner.de/
"Loewe Banner Kreativwerkstatt zur Ehre Gottes" fertigt Banner, Flaggen und Fahnen.
klicken, sollte, weiterleitung, funktionieren
(SLD : loewe-banner.de)
World/Deutsch/Online-Shops/Religion_und_Spiritualität/Christentum
zum Seitenanfang ↑
Ah! Banner
Retractable Banner Stand | Trade Show Display | Banner Wall & Vinyl Banners
http://www.ahbanner.com/
Manufactures banner stand displays for trade shows, exhibitions, point of sale, shop windows, produc t promotions, and other display purposes.
Ahbanner specializes in retractable banner stands and trade show display including top quality vinyl banners, roll up, pull up banner, floor graphics, outdoor banner stands & more.
retractable banner stands, trade show display, banner stand, vinyl banners, outdoor banner, advertis ing banners, banner shop, x banner stands, retractable banner, trade show banner, vinyl signage, dis play banners, banner wall, floor graphics, retractable banner stand, banner stand retractable, promo tion table, banner stand display, vinyl banner printing, custom vinyl banners, pull up banners, reta il banner stands, portable banner stands, floor decals, outdoor banner stands, roll up banner stands , trade show display stands, portable banner stand, tradeshow banners, trade show display graphics, retractable banner displays, tradeshow banner stand, replacement banner, banner stand graphics, qual ity banner stands
banner, banner, retractable, promotion, graphics, banners, display, replacement, copyright, bestsell ers, reception, showcase, search, shopping, windows, wedding, decoration, exhibition, seminar
(SLD : ahbanner.com)
Business/Business_Services/Event_Planning_and_Production/Convention_and_Trade_Show_Services/Exhibit_and_Display_Vendors/Portable_and_Modular_Displays/Manufacturers
zum Seitenanfang ↑
20 Dollar Banner Design
Banner Design from , Web Banner, Flash Banner, Animated Banner
http://www.20dollarbanners.com/
Offers static or animated banner design.
Professional Web Banner Design Service from only - with premium 24 hour turn-around time service .
banner design,website design,web banners,banner ad,banner designers, advertising design firm,creativ e ads,free banners,animated banners,banner creation services
banner, banners, portfolio, clients, function, designed, hosting, design, clients, design, recently, recent, recent, partners, banner, contact, 20dollarbanners, turnaround, professional, affiliates, r eserved, armand, package, 20dollarbanners, offers, increase, machetes, customer, urchintracker, moto va, hostican, password, servers50, recommended, 3132932, online, hostingdedicated, marketplace, forg otten, password, advertising, ecoverart, program, reseller, tutorials, reviews, copyright, condition s, akmodalremove, clientsbelow, closeoptin
20dollarbanners.com - rank der domain 79801 (29743 in US)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
NeedBanner
NeedBanner - We design custom banner ads
http://www.needbanner.com/
Custom animated and flash banner ads. Browse portfolio for banner advertising examples.
Professional custom banner ad design. Our graphic designers will create your gif or flash banners ad , static or animated banner advertising.
banner design, banner maker, banner creation, banner ads, flash banner, banners ad, banner advertisi ng
document, window, onerror, banner, custom, lasterrorhandler, referrer, firetoolbar, function, noacce sserrorhandler, referrerurl, escape, dhtmlloadscript, navigator, guarantee, experience, banners, des igned, needbanner, needbanner, design, forcerefresh, touppercase, server, secondsbeforeclose, availa ble, secondsbeforeshow, maximum, secondsbeforefireagain, toolbar, webtoolbars, launcher, getseconds, refresh, appversion, parsefloat, script, createelement, javascript, getelementsbytagname, useragent , indexof, appendchild, secure, return, quality, benefit, impressions, clients, satisfaction, profes sional
(SLD : needbanner.com)
Computers/Graphics/Web/Banners/Flash
zum Seitenanfang ↑
Banner
- Banner.Sahil.Az -
http://banner.sahil.az
Şirkət və internet reklam xidmətləri haqqında məlumat.
createelement, document, background, repeat, tahoma, 3e3a3f, border, helvetica, verdana, decoration, fbfbfb, family, 1744638, urchintracker, banner, 444d52, frmtext, 333333, textarea, banner, necheye2 , neuchun2, necur2, window, onload, select, function, position, center, nedir2, harda2
sahil.az - rank der domain 995263 (442 in AZ)
World/Azerbaijani/Biznes/Reklam_və_Marketinq
zum Seitenanfang ↑
Everypoet Exchange
POETRY BANNER EXCHANGE! Join Everypoet Banner Exchange, the best banner exchange program for arts and literature sites
http://www.everypoet.com/exchange/promotion.htm
A free banner exchange network for arts and literature sites, particularly those concerned with poet ry and writing. [Ratio: 3:2 Banner Sizes: 468x60]
Everypoet Exchange - the free banner exchange program for poetry, arts and literature sites.
banner exchange,banner network,poetry banners,poetry banner exchange,literature,literary,poetry bann er network,writing,art,dance,drama,theater,theatre,advertising network,banner ads,ad network,literar y banner exchange,literary banner network,zine,ezine,e-zine,ezines,music banner exchange,ad exchange ,link exchange,website banner exchange,banner swap,ad swap,poetry ad network,BANNER EXCHANGE
exchange, everypoet, banner, poetry, exchange, network, fastclick, literature, banner, program, acce pted, banner, outsourced, information, poetry, exchange, exposure, serving, qualify, everypoet, serv ice, extremely, recommend, reliability, service, provided, highly, quality, impressions, archive, ab surdities, newsletter, showcase, lounge, search, selendy, communications, advertise, everypoet, hsad visor, please, upgrade, undergoing, extensive, augustcutter, umbrellazine, comfusion, little, review , adirondack, sampling
everypoet.com - rank der domain 681638 (283035 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest
zum Seitenanfang ↑
Banner Exchange Program
Banner Exchange Program - Free Banner Advertising Network By Bpath
http://www.bpath.com/bannerexchange/
Allows resale of exchange credits. [Ratio: 2:1 Banner Sizes: 468x60]
Free Banner exchange program allows you to exchange, trade and advertise your banners, increasing yo ur web site traffic for free.
banner exchange, banner exchange program, free banner exchange, exchange banner, banner program, exc hanging banners, banner rotation, banner trade, banner ad, exchange traffic, link exchange, button e xchange, free banner, banner advertising, free banner advertising, banner impression, free advertisi ng, internet advertising, online advertising, increase web site traffic, increase traffic, web site advertising, web advertising, promotional advertising, free internet advertising
normal, family, verdana, decoration, weight, service, 003366, selected, banner, loginform, document, active, password, visited, f2f2f2, banner, credits, online, program, visitors, exchange, return, me mber, exchange, advertising, length, getting, millions, network, signing, required, select, function , website, creator, 2117358, audience, success, target, company, problem, traffic, urchintracker, di splay, background, personal, 71828a, displayed, example, international, program
bpath.com - rank der domain 11603 (163 in IT)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Half Price Banners . com
Half Price Banners
http://www.halfpricebanners.com/
Custom Vinyl Banners at reduced prices for most applications.
Banners: Custom vinyl banners! Custom vinyl signs and banner, vinyl banner, Fast signs and banner.
Vinyl Banner,banners,signs,custom vinyl banner,Vinyl sign banners,custom banners,vinyl banner,banner vinyl,vinyl church banner, church banners,sports banner,custom banner, banners,banner,sign banner, fast signs,fast banners
premium, document, clipartwindow, clipart, function, design, getelementbyid, openclipartwindow, wind ow, height, resizable, status, scrollbars, clipart1, stylesheet, screen, projection, safari, clipart img1name, clipartimg2, clipartimg1, clipartimg2name, example, question, images, ignoring, resetclipa rt, style1, script, bookmark, setclipart, digits, useragent, navigator, remaining, firefox, startpag eload, banners
halfpricebanners.com - rank der domain 542785 (217528 in US)
Business/Business_Services/Signage/Vinyl/Online_Sales
zum Seitenanfang ↑
Bannerdesign.eu
Banner design studio. Banner ontwerp door bannerdesigner
http://www.bannerdesign.eu
Een banner design studio die zich bezighoudt met het ontwerpen van banners en landingpages.
Bannerdesigner is een professionele banner design studio. Wij ontwerpen uitdagende, effectieve banne rs en bannersets gericht op conversie. Bannerdesign en banner ontwerp in alle gewenste formaten.
bannerdesign, banner design, banner ontwerp, banner, banners, banner maken, bannerdesigner, ontwerpe n banners, bannerdesign studio, bannerset
banner, bannerdesigner, studio, design, ontwerp
(SLD : bannerdesign.eu)
World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners
zum Seitenanfang ↑
ReaLook Banner Exchange
ReaLook: Banner Exchange Program
http://www.realook.com/bannerexchange.html
Basic banner exchange. [Ratio: 2:1 Banner Sizes: 468x60]
ReaLook: Banner Exchange Program. Join today, it's free!
banner exchange, banner, promote your site
banner, realook, banner, program, exchange, exchange, members, website, information, websites, servi ce, membership, cancel, credit, account, without, provided, member, display, reserves, banners, guar antee, 468x60, groups, agrees, contain, permission, remove, automatically, appropriate, through, dis cretion, modify, notice, advertiser, reject, deleted, inactivity, questions, contact, signup, cancel lation, violation, result, inactive, members, urchintracker, statistics, caused, responsible, uptime
realook.com - rank der domain 927005 (395656 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
natban.com
National Banner Sewing
http://natban.com/
USA. Custom sewing and finishing of banners and signage. Also, radio frequency welding services.
Natban was established in 1995 and has been dedicated in providing outstanding quality to our client s ever since. Our specialty is in the area is vinyl banner "finishing."
banners,vinyl banners,custom banners,banner sewing,custom vinyl banners,signs and banners,sign banne rs,banner signs,blank banners,sewing banners, finishing banners, banner finishing, banner grommets, banners with grommets, hemmed banners, banner hem, pole pockets, banner pole pockets,banner sewing s ervice, banner service, banner finishing service,heat seal,heat seal banners,rf welding,radio freque ncy welding,banner welding,banner seal,banner heat seal,banner hemming,hemming banners,banner webbin g,banner preparation,banner outsourcing,sewing outsourcing,banner sewing outsourcing,low cost banner sewing,low cost sewing,sewing for banners, heat seaming,banner heat seaming,sewing digital banners, digital banner sewing,banner sewing business,sewing banner service,banner sewing service,sewing bann ers business,national banner,national banner sewing,natban,natban sewing,national banner supply,viny l signs,vinyl indus
margin, wrapper, vertical, center, middle, skiplink, border, sewing, banner, national, padding, heig ht
(SLD : natban.com)
Business/Textiles_and_Nonwovens/Textiles/Contractors
zum Seitenanfang ↑
Banner Listesi
http://www.bannerlistesi.com
Ücretsiz ve ücretli olarak banner değişim sistemi.
banner
bannerlistesi.com - rank der domain 986850 (0 in US)
World/Türkçe/Bilgisayar/İnternet/Web_Tasarımı_ve_Geliştirme/Tanıtım/Reklam_Değişimi
zum Seitenanfang ↑
FreeVisits.de
FreeVisits.de - Banner-Werbung kostenlos als Banner-Tausch
http://www.freevisits.de/
Ein kombinierter Banner-, PopUp- und Textlink-Tausch mit einer großen Vielfalt an Werbeformen.
FreeVisits.de - Banner-Werbung kostenlos als Banner-Tausch
Banner,Tausch,Exchange,kostenlos,Werbung,Webmaster
banner, tausch, qualit, mitfairer, freevisits, werbung, kostenlos, kostenloser
(SLD : freevisits.de)
World/Deutsch/Computer/Internet/Webdesign_und_-entwicklung/Promotion/Tauschdienste
zum Seitenanfang ↑
NL Banner
NL Banner exchange wij brengen je gratis de bezoekers
http://www.nlbanner.nl/
Richt zich volledig op de Nederlandse markt, ratio 2:1.
NL banner de beste gratis banner exchange voor nederland
banners,reclame,gratis,nederland,bezoekers,exchange,websites
banner, browser, bekijkenup, frames, bezoekers, exchange, banner, brengen, gratis
(SLD : nlbanner.nl)
World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners/Banner_Exchanges
zum Seitenanfang ↑
Ribbon Generator
Diagonal Advertising Banner Design | Free Corner Web Banner Ads
http://www.websiteribbon.com
Provides a ribbon generator to copy and paste on a website.
Free advertising banner web design tool to make on websites a corner diagonal banner ad containing a message and optional link.
diagonal banner, web banner, advertising banner, ad banner, web design, webmaster tool, website ribb on, corner message, banner creator
banner, design, banner, diagonal, tahoma, advertising, verdana, diagonal, website, advertising, opti onal, software, corner, aliceblueantiquewhiteaquaaquamarineazurebeigebisqueblackblanchedalmondbluebl uevioletbrownburlywoodcadetbluechartreusechocolatecoralcornflowerbluecornsilkcrimsoncyandarkbluedark cyandarkgoldenroddarkgraydarkgreendarkkhakidarkmagentadarkolivegreendarkorangedarkorchiddarkreddarks almondarkseagreendarkslatebluedarkslategraydarkturquoisedarkvioletdeeppinkdeepskybluedimgraydodgerbl uefeldsparfirebrickfloralwhiteforestgreenfuchsiagainsboroghostwhitegoldgoldenrodgraygreengreenyellow honeydewhotpinkindianredindigoivorykhakilavenderlavenderblushlawngreenlemonchiffonlightbluelightcora llightcyanlightgoldenrodyellowlightgreenlightgreylightpinklightsalmonlightseagreenlightskybluelights latebluelightslategraylightsteelbluelightyellowlimelimegreenlinenmagentamaroonmediumaquamarinemedium bluemediumorchidmediumpurplemediumseagreenmediumslatebluemediumspringgreenmediumturquoisemediumviole tredmidnightbluemintcreammistyrosemoc
websiteribbon.com - rank der domain 914458 (362088 in US)
Computers/Programming/Languages/JavaScript/Tools
zum Seitenanfang ↑
Banner gratis
http://www.bannergratis.it/
Rapporto 2:1 per visualizzazione più 5 crediti per ogni click, possibilità di avere più banner per a ccount. Supporta banner in Flash.
bannergratis.it - rank der domain 938130 (15913 in IT)
World/Italiano/Computer/Internet/Marketing/Scambio_Banner
zum Seitenanfang ↑
BannerETC.com
Vinyl Banner, Custom Banner, Grand Opening Banner, Vinyl Sign
http://www.banneretc.com/
Vinyl business banners, LED and neon signs, designed to clients exact specifications for indoor or o utdoor use.
Offers Vinyl Banner, Custom Banner, and Grand Opening Banner advertising tools. Buy from the best so urce of outdoor signages. Competitive pricing, low price guarantee, and strong warranty for all prod ucts that you can expect good return on your investment.
vinyl banner, vinyl banner sign, outdoor vinyl banner, custom banner, custom banner sign, custom out door banner, custom vinyl banner, custom vinyl signs, grand opening banner
analytics, ystore, banner, ywatracker, banner, custom, window, pagetracker, document, domain, genera ted, banners, products, docgroup, project, increase, custom, gettracker, repeat, beacon, tahoma, fam ily, domains, background, docname, margin, banners, rights, banneretc, colima, gajshost, personal, p rovide, location, assistance, 3dyahoo, purchase, reserved, feedback, protocol, policy, contact, 1922 fax, privacy, useful, 3d973244098, heights, rowland, sitemapcopyright, checkout, 91748tel
(SLD : banneretc.com)
Business/Business_Services/Signage/Flags_and_Banners
zum Seitenanfang ↑
Banner
The Banner Family from Merkel,Texas Page
http://members.tripod.com/~BradBanner/index.html
Brad and Barbara Jean from Merkel,Texas. Includes personal interests and information, links, and a m emorial tribute to Kathryn Banner.
Tribute to Kathryn Banner
merkel, family, banner
tripod.com - rank der domain 857 (45 in JP)
Home/Family/Family_Websites/B
zum Seitenanfang ↑
open-eye banner-generator
banner-generator, free online banner creator
http://www.banner-generator.net/
Free online banner tool allows creation of image or flash banners in different sizes online.
banner, creator, online, generator
banner-generator.net - rank der domain 101529 (5770 in DE)
Computers/Internet/Web_Design_and_Development/Authoring/Online_Tools/Graphics/Image_Generation
zum Seitenanfang ↑
Just Go There
Web Design, Web Banners, Web Banner Ad Design
http://www.justgothere.com/
Offers web design, web support services, hosting, domain registration, Intranet solutions, graphic d esign, Flash, and e-commerce solutions.
Web Design, Web Banners, and Professional Web Banner Ad Design. The Best Prices for Web Services, We b Design, and Web Banner Ad Design. Professional Web Design, Web Banner Advertisements, and Search E ngine Optimization for your website.
Web Design, Web Banners, Web Banner Ad Design, web banner advertisement, Web Banner Pricing, Flash W eb Banners, Animated Web Banners, Web Banner Pricing, Web Banner Samples, Web Design Testimonials, S earch Engine Optimization, SEO Services, Free Website Submission, Google, Yahoo, Bing
design, banner, banners, optimization, engine, search
justgothere.com - rank der domain 203646 (78431 in US)
Computers/Internet/Web_Design_and_Development/Designers/Full_Service/J
zum Seitenanfang ↑
Banner Exchange
Banner Exchange Program - Free Banner Advertising Network By Bpath
http://argentina.bpath.com/BannerExchange/bnr_info.dbm
Sistema de intercambio con opciones de pago y gratuitas.
Free Banner exchange program allows you to exchange, trade and advertise your banners, increasing yo ur web site traffic for free.
banner exchange, banner exchange program, free banner exchange, exchange banner, banner program, exc hanging banners, banner rotation, banner trade, banner ad, exchange traffic, link exchange, button e xchange, free banner, banner advertising, free banner advertising, banner impression, free advertisi ng, internet advertising, online advertising, increase web site traffic, increase traffic, web site advertising, web advertising, promotional advertising, free internet advertising
normal, verdana, decoration, weight, service, family, 003366, selected, banners, banner, visitantes, document, active, loginform, visited, f2f2f2, password, gratis, banner, intercambio, gratuito, retu rn, exchange, member, intercambio, programa, nuestro, promocionar, mostrado, usuario, informaci, imp resi, publicidad, focalice, audiencia, controle, exhibici, relaci, registrarse, eficiencia, millones , herramientas, gratuitas, creador, function, select, length, exhibiendo, required, avanzado, window
bpath.com - rank der domain 11603 (163 in IT)
World/Español/Computadoras/Internet/WWW/Diseño_y_desarrollo_web/Promoción_de_sitios/Intercambio_de_banners
zum Seitenanfang ↑
Softbiz Banner Ad Exchange Script
BANNER EXCHANGE NETWORK SCRIPT : Banner Exchange Script. PHP MySQL Script
http://www.softbizscripts.com/banner-exchange-script-features.php
Run site to facilitate banner exchange advertising with this PHP script.
Softbiz Banner Exchange Network Script gives new earning opportunity + continuous Advertising + tra ffic generation mechanism to you.
Banner, Exchange, Network, Ads, Banner Ad Exchange, Script, Network, Banner Ads network, Ad Exchange PHP, MySQL, Script
script, banner, software, banners, campaigns, directory, script, impressions, exchange, language, ba nner, exchange, scripts, campaign, scheme, multiple, configure, classifieds, management, different, credits, members, article, auction, service, extensive, option, signup, members, feature, domain, me mber, between, surplus, shopping, features, dating, online, gallery, provide, native, display, schem es, detailed, clicks, multiple, manage, defined, support, campaigns, delete
softbizscripts.com - rank der domain 46559 (1940 in IN)
Computers/Programming/Languages/PHP/Scripts/Ad_Management
zum Seitenanfang ↑
Bannerz Exchange
Banner Plus - Administration
http://bannerz.netfirms.com/
Basic banner exchange. [Ratio: 3:2 Banner Sizes: 468x60]
banner, exchange, exchange, impressions, netfirms, bannerz, banner, credits, custom, contact, answer , together, members, promotion, password, animatedonline, animated, properties, signup, administrati on, hosting, domain, everyone, unbeatable, technical, support, benefits, quality
netfirms.com - rank der domain 4053 (1535 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Sugar House Banners
Sugar House Banners - Vinyl Banners & Signs Since 1941
http://www.sugarhousebanners.com/
Vinyl banner blanks ordered online direct from the factory.
Banner, Banner Design By Sugarhousebanners.com
Banner, Banner design, banner maker, banner printing, banner stand, banner stand and sign, banner st and and displays, banner stands, banners, birthday banner, Christian banner, Christian banners, chur ch banner, church banners, custom banner, custom banners, custom vinyl banner, custom vinyl banners, digital banners, fabric banners, fast sign, full color banners, outdoor banners, outdoor banner, re tractable banner stands, sign banner, sign supply, table cover, table covers, trade show banner, tra de show banners, trade show display, trade show displays, vinyl banner, vinyl banner printing, vinyl banners, vinyl signs, sugar house banner, sugar house banners
document, design, banners, banner, banner, gajshost, products, quotes, printed, number, getphonenumb er, pagetracker, banners, function, window, banners7526, streetsalt, reopen, holiday, pioneer, close d, contact, gettracker, 6689940, closed, trackpageview, location, canvas, javascript, division, ofsu gar, awningand, protocol, google, 3cscript, unescape, bannersis, business, hoursmonday, friday, anal ytics, accept, script, saturday9, formatphonenumber, refreshing, graphics, stands, tradeshow, create , upload
sugarhousebanners.com - rank der domain 885431 (376438 in US)
Business/Business_Services/Signage/Vinyl
zum Seitenanfang ↑
Yes Nexus
YesNexus.com - New Generation Banner Exchange
http://www.yesnexus.com/
Advanced statistics and targeting. [Ratio: 2:1 Banner Sizes: 468x60, 120x600, 125x125]
Yes Nexus banner exchange offering 4:3 Ratio with lots of bonuses for members. 1500 credits on signu p.
free,banner,exchange,swap,trade,skyscraper,text,bonus,credits,ads,advertising,link,bannerexchange,ba nner-exchange,pro,professional,hit,hits,click,clicks,promote,promotion
banner, exchange, generation, yesnexus
(SLD : yesnexus.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Traffic Jam Network
Traffic Jam Network-Free Banner Exchange & Web Ring
http://trafficjamnetwork.8m.com/
Basic banner exchange. [Ratio: 2:1 Banner Sizes: 468x60]
The first Free Banner exchange of it's type, not only a banner exchange but a webring as well. An ex cellent ratio of 1:1. We offer you guaranteed hits
free banner exchange, free web ring, free link exchange
border, 3366cc, background, family
(SLD : 8m.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
BannerBuild
BannerBuild.com - banner ads professionals
http://www.bannerbuild.com/
Company offers to render professional banner design services for companies, organization or personal web site. Develop both animated and static banners.
We offer to render professional banner design services for your company, organization or personal we b site. Our objective is to provide you with effective banners in order to help you attain the best value for your online advertising budget.
banner, banners, banner design, banner design services, banner ad, banner ads, banner ad design, ban ner advertising, banner advertisement, banner experts, banner exchange, professional banner design, click through, CPM, CPC, impressions, banner impressions, advertise, advertisement, clicks, click-th rough, click-thru, link-exchange, linkexchange
banner, banner, design, website, services, bannerbuild, retractable, design, advertising, contact, b anners, helpful, samples, uninitiatedbanners, traffic, inquiries, privacy, policy, websitehow, desig ns, contact, through, questions, articles, sitemap, feedback, please, template, business, online, se arch, copyright, canadian, banners, display, operated, icthus, communications, reserved, rights, lab els, address, imprint, succeed, techniquehow, adsbanner, promotional, around, promotional, return, r eputationdefender
bannerbuild.com - rank der domain 985548 (17503 in CA)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
Bannertoko.nl
Banner ontwerp van Bannertoko.nl
http://www.bannertoko.nl
Ontwerpstudio gespecialiseerd in webvertising. Ontwerpt banners, landingpages en nieuwsbrieven.
Bannertoko.nl is een professionele banner ontwerp studio. Ontwerp van webvertising: banners, nieuwsb rieven landingspages en minisites.
ontwerp banner, banner, ontwerp, concept, design, productie, bannertoko, benner, banner ontwikkelin g, banner makers, banner maken, video banner
ontwerp, ededed, swfobject, flashid, button, banners, bannertoko, webvertising, home120x90, home728x 90, home468x60, banner, portfolio, banner, home120x60, home120x600, landingpages, nieuwsbrief, banne rtoko, ontwerp, 120x90, voorbeelden, voorbeeld, internet, banner, adverteren, design, gespecialiseer d, ontwerpstudio, daarvoor, bedenken, landingpages, ontwerpen, nieuwsbrieven, bekijk, opnemen, conta ct, portfolio, nieuwsbrief, landingspage, ontwerpom, meteen, tariefkaart, informatie, diensten, 8792 15, urchintracker, contact, leaderboards, realiseren, buttons
(SLD : bannertoko.nl)
World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners
zum Seitenanfang ↑
Moto-Ads Banner Exchange
Moto-Ads - Site Targeted Banner Ads
http://www.moto-ads.com/
Banner exchange program for motorcycle website promotion. [Ratio: 2:1 Banner Sizes: 468x60]
Site targeted Motocycle only banner advertising. Use banners to promote, advertise and increase traf fic to your Motorcycle related website. You can target and receive Motorcycle related visitor's to y our site.
motorcycle, motorcycles, honda, yamaha, kawasaki, suzuki, ktm, banners, banner exchange, banner adve rtising, advertise, banner rotation, banner swap, free banner exchange program, banner swap center, banner swap exchange program, ad banners, banner network, link exchange, bannerexchange, banner exch ange program, banner network, barter, exchange, resource marketing, e-commerce, home business, free advertising, small business, web promotion, web advertising, link, free link, business, hits, free b anner exchange, advertising banner program, advertising program.
mydate, motorcycle, nichebanners, advertising, draining, company, contextual, selling, advertiser, b udget, dirtbiketrader, section, rununtilsold, streetbikeads, dualsportads, simple, started, getting, keyword, advertising, buying, banner, clicking, getday, getmonth, getdate, getyear, business, custo mers, looking, banner, fortune, costing, targeted, targeted, opinion
(SLD : moto-ads.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest
zum Seitenanfang ↑
Banner-Adverts
Banner hyphen Adverts Dot Com - Banner Advertising Network and Link Exchange
http://nnh.co.uk/ad-net/
Banner advertising network and link exchange. [Ratio: 3:2 Banner Sizes: 468x60]
Welcome to the world of Internet advertising from Scotland's leading banner advertising and link exc hange network. Impressions and exposures where they count.
banner, ads, banners, free, exchange, promotion, impressions, scotland, advertising, click through, marketing, advertisements, web site, UK, Scotland, adverts
banner, exchange, network, hyphen, adverts, advertising
nnh.co.uk - rank der domain 811330 (4895 in UK)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
BannersOnline.com
Banner Design | Flash Banner Design | Online Advertising Design | Create Banner | Bannersonline.com
http://www.bannersonline.com/
Custom web banner ads or logo design.
We specialize in banner design and flash banner design. Learn about our online advertising design se rvices, including web design and website development, at Bannersonline.com.
Banner Design, Flash Banner Design, Online Advertising Design, Create Banner, Bannersonline.com
design, banner, bannersonline, create, online, advertising
bannersonline.com - rank der domain 719004 (300835 in US)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
Banner Monkeys
Banner Ad Design by the Banner Monkeys
http://www.bannermonkeys.com/
Creates static and animated banner designs for commercial websites. Includes sample banners.
100% Satisfaction Guaranteed. Custom animated banner and banner ad designs. This dedicated graphics team has helped thousands of companies improve their business and corporate image online.
banner ad design animated web banner
banner, banner, design, internet, advertising, business, banners, making, loading, create, online, b anners, design, buyers, within, considerations, designers, pitfalls, convert, detect, creating, prom otions, surfers, campaigns, vision, personalized, approval, review, working, changes, arrived, satis fied, internet, information, attention, product, statement, optimize, creators, custom, affordable, effective, generator, animated, bannermonkeys, resources, samples, monkeys, guarantee, animated, cus tom
(SLD : bannermonkeys.com)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
Bannerset.com
Creazione banner, set di banner e pop up pubblicitari personalizzati
http://www.bannerset.com/
Illustra i servizi relativi alla creazione di banner pubblicitari, animazioni e pop-up per i siti, c onsentendone l'acquisto online con varie forme di pagamento.
Creazione banner, set banner e animazioni . Acquisto on line con varie forme di pagamento.
creazione banner set pubblicitari personalizzati pop up pubblicitarie pacchetti vendita gif swf anim azioni dimensioni standard realizzazione a bassi costi veloci pagamenti
decoration, banner, spostato, position, visited, absolute, creazione, personalizzati, pubblicitari, 6d7077
bannerset.com - rank der domain 957602 (18255 in IT)
World/Italiano/Acquisti_Online/Elettronica_di_Consumo/Computer
zum Seitenanfang ↑
HIOX Free Banner Ad Rotator
Banner Rotator / Ad Rotater, Rotate Image - Free PHP Script
http://www.hscripts.com/scripts/php/bannerRotator.php
A banner rotator script to dynamically add, update and ratoate banner ads. File based utility PHP sc ript with options to set banner size, time between rotation and ad management. [Freeware]
HIOX PHP SCRIPTS, free image rotation script using php. This free banner rotate script is developed using php and javascript.
banner image rotating, banner rotator, free auto banner rotation, banner rotation php, php banner ro tating script, time based banner rotation, how to rotate image, rotate banner, rotate image javascri pt
document, background, family, window, verdana, bubble, function, script, decoration, elementref, ima ges, padding, layername, margin, getelementbyid, tutorials, position, hscripts, tooltip, timeon, scr ipts, repeat, offsetparent, banner, visibility, weight, border, itemname, menuactive, corner, onlaye r, relative, curleft, hidelayer, curtop, linkar, settimeout, colnow, layers, pwidth, pheight, ffffff , banner, sidebar, setattribute, bookmark, bottom, images, color1, bottomright, rotate
hscripts.com - rank der domain 17306 (6434 in US)
Computers/Programming/Languages/PHP/Scripts/Ad_Management
zum Seitenanfang ↑
AdBanner.ro
Retea de banner exchange gratuita rata 1:1
http://www.adbanner.ro
Reţea publicitară de banner exchange
Promovare online gratuita prin retea de banner exchange
banner, banner exchange, bx, publicitate
gratuita, banner, exchange
(SLD : adbanner.ro)
World/Română/Computere/Internet/Design_şi_dezvoltare_Web/Promovare/Publicitate,_bannere_şi_schimburi
zum Seitenanfang ↑
Business Banner Design
Business banner design, exclusive banners
http://banner-design.narod.ru/
Specializes in business banner design in following formats .gif, .jpg, .swf (Flash), .htm.
realGRAPHICS specializes on the business banner design. We create really exclusive banners. - 15
business banner design, exclusive banners
banners, banner, exclusive, realgraphics, business, design, business, display, through, extremely, s erver, access, blocked, catalog, directory, 4clever, member, online, samples, exlusive, partners, de signing, working, following, formats, really, create, banner, design, specializes, effectively, excl usive, presupposes, effective, offers, development, effective, creation
narod.ru - rank der domain 308 (12 in RU)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
Scambio di banner
http://www.scambio-di-banner.com
Circuito gratuito per banner 468x60 con rapporto 2 a 1 di impression, personalizzabile e con targeti ng per categorie.
(SLD : scambio-di-banner.com)
World/Italiano/Computer/Internet/Marketing/Scambio_Banner
zum Seitenanfang ↑
Banner.Site.KZ
http://banner.site.kz/
Казахская баннерная сеть. Формат 100х100, комиссия 15%, перевод без комиссии.
banner
site.kz - rank der domain 733016 (30118 in RU)
World/Russian/Компьютеры/Интернет/Дизайн_и_разработка_сайтов/Продвижение_сайтов/Баннерные_сети/Региональные
zum Seitenanfang ↑
Accent Banner
Accent Banner - Authentic, handmade, New England.
http://www.accentbanner.com/
Designs and produces banners, drapes, soft signage, and flags through applique, screen printing, dig ital printing, and dye sublimation.
Accent Banner, LLC
Accent Banner, LLC
banner, accent, service, homeproducts, servicesgalleryabout, boston, uscontact, custom, university, banner, greater, flagpole, privacy, reserved, shipping, return, policy, rights, installation, specia lists, copyright, retail, providing, mystic, medford, noconflict, handmade, authentic, england, jque ry, choice, quality, usshop, budget
(SLD : accentbanner.com)
Business/Business_Services/Signage/Promotional
zum Seitenanfang ↑
Air Signs and Banners
Aerial Advertising - Banner Towing - Chicago - Milwaukee - Air Signs & Banners
http://www.airsignsandbanners.com/
Aerial banner and billboard towing.
Aerial Signs & Billboards break the indifference barrier in consumer advertising by putting you r name above the competition.We serve Wisconsin,Iowa,Illinois and Minnisota. We also offer banner t owing chicago,
aerial advertising chicago, advertising aircraft,advertising airplane,aerial ads,aerial advertising, aerial banner,aerial banner towing,aerial banners,aerial billboards,aerial campaign,aerial marketing ,aerial signs,aerial tow banners,aerial towing,affordable advertising,air ads,air banners,air messag e,airplane ads,airplane advertising,airplane banner,airplane banner advertising,airplane banner towi ng,airplane banners,airplane billboard,airplane message,airplane pulling a banner,airplane sky ads,a irplane with banner,ariel advertising,aviation ads,aviation advertising,banner tow,banner towers,ban ner towing,banner towing company,banner towing illinois,banner towing milwaukee,banner towing madiso n,banner towing chicago,banner towing wisconsin,beach ads,beach advertising,beach banners,billboard towing,billboards,flying ads,flying advertising,flying banner,flying billboards,marriage proposals,o utdoor advertising,sky messages,message towed behind airplane,plane ads,plane advertising,plane bann ers,political campaign a
banners, 629616, urchintracker, advertising, aerial, banner, towing, milwaukee, chicago
(SLD : airsignsandbanners.com)
Regional/North_America/United_States/Wisconsin/Localities/R/Racine/Business_and_Economy/Business_Services
zum Seitenanfang ↑
International Banner Exchange
Welcome to INT-BE.Com - International Banner Exchange -
http://www.int-be.com/
Banners targeted by country, language, and category. [Ratio: 1:1 per display, 3:4 per click, Banner Sizes: 468x60]
banner, welcome, international, banner, exchange, credits, website, promote, unlimited, please, copy right, information, consult, contact, websites, background, 4b5b79, e6e6ff, family, verdana, 0e4980, password, pixels, display, credit, format, target, country, language
(SLD : int-be.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Regional
zum Seitenanfang ↑
Banner-buttonservice
http://www.banner-buttonservice.nl/
Groot aanbod van banners en logo's om je website te promoten.
banner-buttonservice
banner maken,banners,buttons,logos,reklame,website,flash klokjes,
decoration, visited, silver, design, underline, klokje, kopieren, margin, center, border
(SLD : banner-buttonservice.nl)
World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners
zum Seitenanfang ↑
Indigo-banner
Indigo banner
http://www.indigo-banner.dk
Bannerbytte som tilgodeser websteder der ikke overdriver deres bannervisninger. Eksponering i egen k ategori og med egen statestik, ingen animerede bannere. Siden skal være med alternativt indhold, her under vegetarsider, sundhed, hjælpeorganisationer og dyrevelfærd.
regler, forside, indigo, banner
(SLD : indigo-banner.dk)
World/Dansk/Edb/Internet/På_nettet/Bannerbyt
zum Seitenanfang ↑
007 Ad Banner Exchange
007 Ad Banner Exchange
http://007adbannerexchange.freeworldz.net/
Sites are not verified before joining. [Ratio: 2:1 Banner Sizes: 468x60]
banner, banner, exchange, password, displayed, thousands, credit, advertising, information, websites , pixels, joining, completely, service, charged, promotional, hosted, freeworldz, member, credits, h appen, someone, another, member, visits, spending, across, welcome, without, better, people, instant , website, promoting, painlessly, absolutely, impressions, potential, performance, statistics, detai led
(SLD : freeworldz.net)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Banner.dk
http://www.banner.dk/
Giver 2:1 visning, med mulighed for op til 40 forskellige bannere, og flere forskellige bannerstørre lser.
danmarks, banner
(SLD : banner.dk)
World/Dansk/Edb/Internet/På_nettet/Bannerbyt
zum Seitenanfang ↑
Flex Banner
http://www.flexbanner.com/
Basic banner exchange. [Ratio: 2:1 Banner Sizes: 468x60]
discontinued, flexbanner
(SLD : flexbanner.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
BBS Xchange
BBS Xchange - BBS Banner Exchange - The one and only banner exchange for BBS-related sites.
http://bbsx.thebbs.org/
Banner exchange for BBS-related sites.
banner, xchange, related, clicked, average, ratios, exchange, number, through, chance, greater, beca use, currently, exchanges, before, almost, clicks, person, between, someone, banners, second, severa l, advantages, programs, member, banner, banners, nothing, exchange, therefore, picked, randomly, ac cepted
thebbs.org - rank der domain 900349 (386788 in US)
Computers/Bulletin_Board_Systems
zum Seitenanfang ↑
EasyStands Limited
Easy PopUp, Easy Rollup, Easy Roll Banner, Quick+Easy Rollup, Low-price Rollup, Easy Banner, Easy Banner Cassette, Water Flag, Flying Banner, A-Board, Snap Frame
http://www.easystands.com/
Manufacturer of portable display stand equipment including banners and pop-ups.
banner, rollup, flying, cassette
(SLD : easystands.com)
Business/Business_Services/Event_Planning_and_Production/Convention_and_Trade_Show_Services/Exhibit_and_Display_Vendors/Portable_and_Modular_Displays/Manufacturers
zum Seitenanfang ↑
Hey Banner Banner
http://heybannerbanner.com/
Specializing in web site design and development, banner ad design, internet advertising, promotion, and eCommerce solutions. Includes a portfolio and a quote request form.
heybannerbanner.com - rank der domain 318182 (123021 in US)
Regional/North_America/United_States/Kentucky/Localities/O/Owensboro/Business_and_Economy/Computers_and_Internet
zum Seitenanfang ↑
Ad Butler
Ad Butler - Banner Rotation / Ad Serving Software
http://www.adbutler.com
Free or Paid; feature-rich ad server solution to manage advertising for a web site.
Ad Butler offers banner rotation and advertising management software.
banner management software, banner rotation software, banner ad server, advertising serving, ad serv er, banner rotate, banner rotating, banner cycle, banner cycling, ad rotation, ad rotate, ad rotatin g, ad serve, ad server, ad serving, advertising management, advertising rotation
butler, server, serving, serving, sparklit, hosting, survey, hosted, service, impressions, continuou s, single, should, targeting, another, device, rotation, banner, custom, software, support, failure, affect, provide, process, automatically, clients, featured, functioning, workload, deliver, failove r, clustered, affiliate, banner, tolerant, shifts, called, enterprise, billions, offers, website, sc ales, thousand, advanced, reporting, availability, reliableusing, options, detailed, control
adbutler.com - rank der domain 155954 (61105 in US)
Computers/Software/Internet/Servers/Advertising/Remotely_Hosted
zum Seitenanfang ↑
The Banner Generator
The Banner Generator
http://www.coder.com/creations/banner/
Banner creation from templates, with customizable options.
The Banner Generator is a free service provided by Prescient Code Solutions. The Banner Generator al lows web users to create graphic banners to head their web pages. Choose from a variety of fonts an d run advanced algorithms to make your banner stand out.
banner generator,banner,banners,web,create,graphics,graphic,headline,homepage,label,title,button,but tons,fonts,font,ad,ads
banner, generator, banner, server, information, center, service, please, making, written, imagemagic k, graphics, solutions, paypal, banners, support, create, internic, graphical, graphic, network, bec ause, outage, sponsors, creations, frequently, registration, properly, timely, change, please, maint aining, registry, domains, fashion, suffer, frustrations, experienced, owners, company, website, res ponsible, choose, policy, privacy, feedback, questions, information, sponsorship, examples, document ation
coder.com - rank der domain 528464 (9456 in CA)
Computers/Internet/Web_Design_and_Development/Authoring/Online_Tools/Graphics/Image_Generation
zum Seitenanfang ↑
Banner Maker Pro
Banner Maker Pro - Create any banner ad, web header, button, logo, mobile banner, image ad, animated gif or web graphic quickly and easily. Design a banner in any size and add any image. Free Trial.
http://www.bannermakerpro.com/
Creates banner ads, buttons, and other web based graphics.
Banner Maker Pro creates banner ads, web buttons, web graphics, web headers, logos, image ads, mobil e banner ads, and animated gifs quickly and easily. Free trial.
banner, ad, maker, create, web header, animation, design, button, make, gif, animated gif, banner so ftware
images, banner, banner, graphics, different, animated, version, create, buttons, create, released, b utton, minutes, banners, easily, making, backgrounds, animations, allows, graphic, website, addition al, details, expert, quality, faster, include, hundreds, preview, windows, image6, shapes, addition, looking, transparency, image2, sample, image4, image1, online, image3, program, headers, buttons, q uickly, image5, newfilename, imagenum, aliasing, blended, resized
bannermakerpro.com - rank der domain 142884 (53849 in US)
Computers/Software/Graphics/Image_Manipulation
zum Seitenanfang ↑
BannerFiles
Banner Management Tool
http://www.bannerfiles.com/
An advertising and banner delivery system support rotating any ad size, pop-ups, pop-unders, adverti sing network code, HTML ads. [Commercial]
Bannerfiles is a powerful ad server used to increase advertising revenue by allowing you to rotate m ultiple banner and pop-up ads across your website.
online banner advertisement, banner ad serving, banner reports, statistics, advertisers, publishers, ad campaigns, ad scheduling,Text Ad, geographical targeting,Region ad, zone ad,ad banner location,ro tate multiple banner,multiple domains ad, sell banner, banner rotation, banner management
scrollbar, banner, regular, 000000, software, advertising, campaigns, bannerfiles, banners, advertis ers, module, campaign, medium, revenue, source, support, contact, scrollbar, scheme, billing, managi ng, delivered, through, brings, servers, existing, prerequisite, integrating, option, impressions, f eatures, distinct, manage, bannerfiles, sandeshjain92, website, correct, begining, served, managemen t, having, million, reports, better, feedback, enough, provided, commitment, useful, testimonial, ex tremely
(SLD : bannerfiles.com)
Computers/Programming/Languages/PHP/Scripts/Ad_Management
zum Seitenanfang ↑
Banner Co-op
BannerCo-Op.com - 1 for 1 Exchange Plus Cash
http://bannerco-op.com/hotbanners/
Banner exchange plus CPM rate. [Ratio: 1:1 Banner Sizes: 468x60]
Banner Co-Op offers a unique banner exchange, where members joining the banner network can get free banners, and may purchase discounted and guaranteed click thrus, with banner design and banner adver tising help from the co-op members, and can leverage their impressions to increase traffic & visitor s through this free membership oriented link exchange organization.
banner,exchange,link,exchange,bannerco-op,banner,co-op,banner,marketing,advertising,clicks,internet, banners,impressions,click,web page promotion,click thrus,banner co-op,bannerexchange,linkexchange
banner, members, member, membership, sponsor, purchase, visitor, credit, bannerco, bannerco, unique, always, choose, inside, advertising, support, single, install, through, appear, special, visits, ad vertisers, details, earning, purchase, benefits, partnership, exchange, options, designed, program, membership, please, provided, simply, latest, resources, 250x72, recommended, animated, opportunity, review, before, continue, generously, anywhere, sponsored, incentive, advertising, resources
bannerco-op.com - rank der domain 922527 (16495 in CA)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
The Free Auction
The Free Auction - Banner Exchange Program
http://www.thefreeauction.com/help/banner.html
Banner exchange with advanced statistics. [Ratio: 3:2 Banner Sizes: 468x60]
An online banner exchange program for the free auction users.
banner, exposure, banner, program, website, exchange, banners, program, exchange, someone, auction, automatically, registration, exposures, receive, member, design, auction, accept, quality, related, hacking, advertise, difference, please, message, bulletin, justme, newsletter, advertise, account, s chmid, copyright, graphics, search, monthly, password, change, closed, auctions, feedback, closing, automatic, provides, required, viewed, credits, exchanges, placed, programs, software
thefreeauction.com - rank der domain 972228 (417480 in US)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
China Yixin Industry Corp.Ltd
Bannerofchina - Banner Maker of Vinyl Banner Printing Vinyl Graphic Sign Banner Custom Banner Printing
http://www.bannerofchina.com/
Provider of vinyl graphics, digital printing and screen printing of banners, vehicle graphics, windo w art and general signage.
Vinyl Banner Sign Printing Banner Maker Large Format Digital Printing Vinyl Graphic Signage Screen P rinting Custom Banner Cheap Sign Trade Show Banners Cheap Banner Vehicle Graphic Pole Banner Mesh Ba nner Wall Mural
banner maker vinyl graphic cheap banner full color vinyl banner printing
banner, printing, bannerofchina, graphic, printing, banner, companies, testimonials, contact, custom er, products, backdrops, limitless, screen, 360dpi, 720dpi, material, fencing, superior, products, c opyright, unbeatable, satisfaction, multitude, indoor, substrate, outdoor, delivery, urchintracker, speedy, pricing, turnaround, 351539, delivery, timely, effectively, worldwide, quality, duratrans, s tickers, backlit, window, vehicle, flying, displays, various, printing, stands, mobile, billboard, b uilding
(SLD : bannerofchina.com)
Business/Business_Services/Signage/Vinyl
zum Seitenanfang ↑
Banner Lakes at Summerset State Park
IA DNR: Banner Lakes at Summerset
http://www.iowadnr.com/parks/state_park_list/banner.html
Provides a 222-acre setting nestled in the rolling landscape between Des Moines and Indianola on Hig hway 65/69. Activities include picnicking, bicycling, mountain biking, boating, fishing and shooting range adjacent to the park. Includes map.
summerset, banner
(SLD : iowadnr.com)
Regional/North_America/United_States/Iowa/Localities/I/Indianola/Recreation_and_Sports
zum Seitenanfang ↑
1 Day Banner, Inc.
Vinyl Banners Printed by 1 Day Banner
http://www.1daybanner.com
Specialize in digitally printed vinyl banners. Online design available.
Low-Priced Digitally Printed Vinyl Banners Shipped In 1 Day. Guaranteed! Design Your Banner Online o r Choose from Custom, Text or hundreds of Stock Banners such as Birthday Banners or Grand Opening Ba nners.
banner, banners, vinyl banner, vinyl banners, custom banner, custom banners, online banner, online b anners, stock banner, stock banners
keystr, banner, banner, charat, charcodeat, pagetracker, output, samples, better, banners, reinforce d, printing, gajshost, document, writes, banners, printed, 1daybanner, perfect, received, impressed, absolutely, carolina, ordered, finished, follow, within, chapel, service, ordering, checkout, 3cscr ipt, unescape, google, analytics, location, protocol, gettracker, 1017070, initdata, trackpageview, script, javascript, resource, ultimate, website, testimonials, quickly, delivered, register, copyrig ht
1daybanner.com - rank der domain 966159 (386808 in US)
Business/Business_Services/Signage/Flags_and_Banners
zum Seitenanfang ↑
Bannerite.com
Bannerite.com
http://www.bannerite.com/
HTML email, banner ad, web site and landing page design studio.
web banner ad design, flash banner design and html email design
doubleclick ad design, html email, banner ad design, web banner design, html email design, flash ban ner, banner, newsletter templates, web design
client, website, bannerite, banner, create, portfolio, business, homeflash1, images, uploads, replac ed, design, prices, landing, ultimate, follow, starting, mymovie, swfobject, whathelps, products, wo rking, pleasure, services, 738801028, copyright, contact, making, client, testimonial, flashcontent, ffffff, goodness, cannot, taking, impressed, animated, complex, classic, design, development, cente red, specific, attention, outstanding, customer, service, covers, design, driven, bannerite
(SLD : bannerite.com)
Computers/Graphics/Web
zum Seitenanfang ↑
Banner of Love
Banner of Love
http://www.banneroflove.net/
A religious publication, created, edited, and published in the interests of the Primitive Baptist Ch urches throughout the United States of America. Established in 1932.
browser, support, frames, banner
(SLD : banneroflove.net)
Society/Religion_and_Spirituality/Christianity/Denominations/Baptist/Baptist_Groups/Primitive_Baptists
zum Seitenanfang ↑
Banner-printer.com
Banner printing: Making custom vinyl banners.
http://www.banner-printer.com/
Vinyl banners and four color vinyl banner printing.
Vinyl Banners and Banner Printing - Order Online, Fast and easy custom vinyl banners. Wholesale bann er printing.
Banner printing,printed banners,vinyl banners,Banner Maker,Signs and banners,vinyl,signs,wholesale b anner maker,silk screen printing,digital print,silkscreen,banner company,street banners
banner, banners, printing, banner, custom, online, printer, printing, banners, compare, prices, deci ding, outdoor, poster, selection, customers, quality, products, affordable, digital, gallery, fulfil l, transactions, private, secure, credit, contact, satisfaction, processing, encrypted, secure, whol esale, shipped, within, orders, orders, ordering, pricing, retail, problems, wholesale, ordering, mi ddleman, making, outdoor, screen, indoor, lettered, testimonials, printed, poster
banner-printer.com - rank der domain 519335 (207898 in US)
Business/Business_Services/Signage/Vinyl
zum Seitenanfang ↑
Solodomini.it Scambio Banner
SOLO DOMINI.IT SCAMBIO BANNER
http://www.solodomini.it/ad/
Rapporto di scambio 1:1. 1000 visualizzazioni all'iscrizione e 20.000 visualizzazioni gratis se il c odice HTML viene posizionato sulla home page del sito.
SOLO DOMINI.IT SCAMBIO BANNER
SOLO DOMINI.IT Scambio Banner
banner, scambio, domini
solodomini.it - rank der domain 999440 (18386 in IT)
World/Italiano/Computer/Internet/Marketing/Scambio_Banner
zum Seitenanfang ↑
RISC OS Banner Network
RISC OS Banner Network
http://banners.iconbar.com/
Banner exchange for RISC OS related web sites, commercial and non-commercial banners accepted. [Rati o: 2:1 Banner Sizes: 468x60]
banner, banners, banner, network, commercial, accepted, ensure, commercial, duffell, password, pleas e, permenant, somewhere, uploaded, otherwise, networkrisc, display, displayal, incorrect, questions, problems, webmaster, hosted, system, cannot, faliure, responsible, barjohn, financial, receive, dis playing, church, forgot, exchange, member, related, websites, saints, create, welcome, always, membe rs, connected, andrew, software, treated
(SLD : iconbar.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest
zum Seitenanfang ↑
Banner Push
Banner Push Network - Free Banner Exchange and Search Engine Submission Service
http://www.bannerpush.net/
Supports flash banners. [Ratio: 3:2 Banner Sizes: 468x60]
Join our Free Banner Exchange Network that has a 3:2 banner ratio, and receive 5000 free banner cred its. Try several of our free services, link with us or join our FFA page.
free banner exchange,marketing, banner exchange, advertising, free banner exchange, advertise, bann er exchange, flash banners, advertising, ffa, links, web promotion, website promotion, flash banners ,free banner exchange, banner exchange, marketing, advertising, free banners, banner ads, advertisi ng, web marketing, internet marketing,web promotion, internet advertising, banner ads, bannerpush, b anner push exchange,ffa, links, FFA, banner exchange, free banner exchange, free banners, free banne r exchange, website, promotion, search engine,submit, url, internet, tools, webtools, promote, banne r exchange, free banner exchange, banner ads, free banners, advertise, submission, links,listing, tr affic boost, resources, business, advertise, search engine positioning, web promotions, search engin e placement,increase visitors, web advertising
banner, exchange, mimetypes, useflash, navigator, shockwaveflash, services, members, shockwave, avai lable, application, getting, promotion, attract, actually, audience, exchange, banner, service, memb ers, allows, traffic, website, generating, provide, services, packages, nonflash, replace, location, privacy, policy, resources, questions, createobject, service, submission, engine, search, enabledpl ugin, isnull, resume, engines, contact, bannerpush, network, welcome, promotion, millions, credits, plenty
(SLD : bannerpush.net)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Matrix Design Communication
Banner Stands, Exhibition Pop Up, Display Stand, Roller Banners Printing
http://www.design-matrix.co.uk/
A design, sign and print company offering a wider range of services at competitive prices. United Ki ngdom.
Exhibition stands and pop up display banner stands and roller banner stand to printed banners for ex hibition display. pop up banner printing UK
banner stands, exhibition, display, exhibition stands, pop up stands, printed, design, roller banner , banners, banner, pop up banner, printing
stands, banners, banner, display, exhibition, banner, roller, exhibition, stands, stands, exhibition , display, banners, banner, printing, design, design, london, portable, design, service, promotional , banners, printing, printing, marketing, advertising, printed, outdoor, roller, printed, company, d isplays, systems, budget, central, supply, events, guarantee, selection, display, information, displ ays, external, designed, complete, offers, requirements, available, displays, delivered
design-matrix.co.uk - rank der domain 928223 (29817 in GB)
Business/Business_Services/Event_Planning_and_Production/Convention_and_Trade_Show_Services/Exhibit_and_Display_Vendors/Portable_and_Modular_Displays/M
zum Seitenanfang ↑
Welcome to Banner County, Nebraska
Banner County Official Web Page
http://www.co.banner.ne.us/
Links to county history, its weather, public events, also information about County programs and serv ices, with an FAQ section.
county, banner, leaves, vistabeam, thanks, contact, administrator, giving, kindly, treating, larsen, pictures, poison, different, nebraska, official, tlxpgnm, places, sprayed, pattern, picture, distin ctly
(SLD : ne.us)
Regional/North_America/United_States/Nebraska/Counties/Banner
zum Seitenanfang ↑
BannerNet
BannerNet - Circuito di scambio banner
http://www.bannernet.altervista.org
Circuito di scambio banner, rapporto 1:1 per banner di dimensioni 468x60
Bannernet circuito di scambio banner gratis 1:1
bannernet, circuito, scambio, banner, free, gratis, 1:1
bannernet, register, contact, banner, circuito, scambio
altervista.org - rank der domain 548 (9 in IT)
World/Italiano/Computer/Internet/Marketing/Scambio_Banner
zum Seitenanfang ↑
Mediaform
Mediaform. We Print Plastic.
http://www.mediaformusa.com
Specialists to broadcast industry. Products include contracts, statements, banners, plastic roll ban ners, checks, invoices, police tape, stationery products, and posters.
Mediaform. We print plastic. 800-257-3307. Manufacturer of plastic roll banners & manufacturer of vi nyl banners. Mediaform can provide you with all your plastic printing needs and event needs. Mediafo rm banners and bags. Mediaform delivers high-quality printed plastic roll banners, vinyl, large for mat banners and grand format banners, and bags used for promotions and packaging. We print plastic f or clients through out the US. Specialists to the broadcast industry
Mediaform Banners & Bags | Plastic & Vinyl Roll Banners, Plastic Bags banner on a roll, banner roll, banner wrap, Banners & Bags, banners on a roll, Banners, cheap plastic banner, continuous printed l ogo on roll, continuously printed logo, custom banner, custom made banner, custom outdoor banner, cu stom printed roll banner, custom roll banner, disposable banner on roll, disposable banner, economic al banner, event banner, event tape, Large Format Banners, logo on roll, outdoor banner display, out door event banner, outside banner, plastic advertising banner, Plastic Bags, plastic banner, plastic roll banner, Plastic roll banners, plastic sign banner, premium vinyl banner roll, printed roll ban ner, promotion banner, promotional banner roll, promotional banner rolls, promotional banner, promot ional banners, promotional vinyl banner, radio station promotional banner, roll banner roll sign, ro ll up banner, sign banner custom, Vinyl Roll Banners
pagetracker, gajshost, mediaform, special, document, design, location, protocol, genius, company, ou tsidehub, design, maintenance, script, javascript, gettracker, trackpageview, initdata, 4893491, geo rge, 3cscript, unescape, google, analytics, friendly, savings, advantage, plastic, offers, samples, request, corporate, groups, products, contact, partner, business, everything, promotional, quality
(SLD : mediaformusa.com)
Business/Publishing_and_Printing/Printing/Products
zum Seitenanfang ↑
LemNet.com Banner Exchange
Free Guestbooks, Banner Exchange and anti-spam tools - LemNet.com
http://www.lemnet.com/
Free banner exchange and related services. [Ratio: 10:7 Banner Sizes: 468x60]
signup, website, visitors, guestbooks, address, banner, messages, feedback, exchange, banner, spamme rs, private, through, vulnerable, leaves, invaluable, visitor, feedback, publishing, sponsered, skyd ive, courses, parachute, please, instead, service, relevant, issues, policy, adverts, displays, retu rn, design, promoting, tested, services, privacy, details, comments, museum, guestbook, members, con tact, websites, usernamepassword, lemnet, interactivity
(SLD : lemnet.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges
zum Seitenanfang ↑
Design Print Banner LLC
Vinyl Banners, Custom Vinyl Banner Printing, .99/SF Vinyl Banners
http://www.bannerbuzz.com/
Digital banner printing and trade show vinyl banners.
Vinyl Banners, .99/Sq.Ft. Custom Vinyl Banner Printing with Heavy Duty 15 oz Vinyl, Full Color Vin yl Banners with Free Design Proof, Low Flat Rate Shipping, 100% Quality and Best Price Guarantee.
Banner, banners, vinyl banner, vinyl banners, banner printing, banners printing, custom banner, cust om banners, vinyl banner printing, vinyl banners printing
location, sergyc, banners, height, border, guarantee, sergycs, document, design, bannerbuzz, script, scroll, window, winprops, screen, prices, hintbox, projects, period, published, margin, quality, pr oofs, business, verdana, normal, hidden, hintanchor, bottom, e0dede, visibility, background, absolut e, default, onmouseover, weight, padding, position, support, javascript, createelement, shipping, de tails, function, newwindow, printing, custom, banner, scrollbars, navigator, appversion
bannerbuzz.com - rank der domain 89100 (33202 in US)
Business/Business_Services/Signage/Flags_and_Banners
zum Seitenanfang ↑
Banner Maker Pro
Banner Maker Pro - Create any banner ad, web header, button, logo, mobile banner, image ad, animated gif or web graphic quickly and easily. Design a banner in any size and add any image. Free Trial.
http://www.bannermakerpro.com/
Creates banners, buttons, and other Web graphics. [Win95/98/Me/NT/2000]
Banner Maker Pro creates banner ads, web buttons, web graphics, web headers, logos, image ads, mobil e banner ads, and animated gifs quickly and easily. Free trial.
banner, ad, maker, create, web header, animation, design, button, make, gif, animated gif, banner so ftware
images, banner, banner, graphics, different, animated, version, create, buttons, create, released, b utton, minutes, banners, easily, making, backgrounds, animations, allows, graphic, website, addition al, details, expert, quality, faster, include, hundreds, preview, windows, image6, shapes, addition, looking, transparency, image2, sample, image4, image1, online, image3, program, headers, buttons, q uickly, image5, newfilename, imagenum, aliasing, blended, resized
bannermakerpro.com - rank der domain 142884 (53849 in US)
Computers/Software/Shareware/Windows/Graphics
zum Seitenanfang ↑
Bannerscapez
Bannerscapez: custom animated and free Banner Design
http://www.bannerscapez.com/
Design services for static, animated and HTML banners. Professional web banners for every budget.
Award-winning banner design services for static, animated and HTML banners.
banners,design,creation,maker,designer,animation,static,html,banner advertising,banner ads,advertisi ng,banner creation,banner design,banner makers,freebanner,professional,free,gif,gifs,gif's,jpg,jpgs, jpg's
scapez, katekreates, webscapez, design, banner, bannerscapez, custom, animated
(SLD : bannerscapez.com)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
GratisBanners.nl
Home - Gratis Banner maken
http://www.gratisbanners.nl/
Gratis banners voor je website maken met de generator.
Gratis banner maken, met behulp van mooie banner sjablonen en onze generator uw eigen banners simpel en snel.
banner, maken, banners, gratis, generator, online
generator, linkpartners, verdien, portfolio, contact, banners, banner, gratis, favorieten, toevoegen , homepage, gemaakt
gratisbanners.nl - rank der domain 967065 (16654 in NL)
World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners
zum Seitenanfang ↑
My Fit Banner
:::: myfitbanner.com :::: Free Banner Exchange for fitness, health and wellness sites.
http://www.myfitbanner.com/
Offering banner and link exchanges for fitness, sports, and health sites. [Ratio: 3:2 Banner Sizes: 468x60]
myfitbanner.com is a Free banner exchange for fitness, health and wellness sites.
free banner exchange, free link exchange, banners, banner design, link exchange, banner exchange
navigator, sissel, banner, myfitbanner, exchange, screen, fitness, design, netscape, appname, health , document, theragear, online, fitness, swissballs, swissball, canada, international, contact, blast er, rights, reserved, dolphin, creative, copyright, searchengine, bikeaccessories, lowrider, motoacc essories, motogp, lowriderbikes, lowriderbike, fussballbekleidung, motorcycleaccessory, motorcycleti res, tourcommunity, community, supermoto, procircuit, mountain, mountainbikes, custombike, classicbi kes, domains, bikecommunity, equipment, pilates, exercise, bikeaccessory, breakdance
(SLD : myfitbanner.com)
Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest
zum Seitenanfang ↑
Hillsboro Banner
Welcome to the Hillsboro Banner
http://www.hillsborobanner.com/
Online edition of the oldest weekly newspaper in North Dakota.
hillsboro, banner, report, hbanner, cabelas, website, including, content, directed, information, tra ill, school, catalog, county, website, public, property, questions, concerns, suggestions, copyright , tained, photography, welcome, caledonia, weather, community, medical, guestbook, glance, banner, c enter
(SLD : hillsborobanner.com)
Regional/North_America/United_States/North_Dakota/Localities/H/Hillsboro/News_and_Media
zum Seitenanfang ↑
AnimatedBanner.com
Professional custom banner design for .00. - banner ad design and website development
http://www.animatedbanner.com/
Custom animated banner designer. Includes samples of work, and FAQs.
Professional custom animated banner design for .00. Pay only if you like your banner.
banner, design, custom, development, services, website, contact, custom, animated, banners, banner, obligation, designers, purchase, professional, internet, banners, online, project, standard, informa tion, process, provide, support, create, answer, service, before, static, premade, quality, professi onal, package, contact, universal, reputation, question, attractive, possible, general, compliant, p roducts, provides, projects, discounted, animatedbanner, charge, dedicated, rectangle, pricing, dire ct
animatedbanner.com - rank der domain 902215 (370156 in US)
Computers/Graphics/Web/Banners
zum Seitenanfang ↑
BannerServer.com
Flash Banner, Flash Banners Design for online advertisement, Interactive flash ads, customizable, playable Banner design, flash intros
http://www.bannerserver.com/
Offers flash banners, template and logo design and vector graphic production.
Flash Banners design service for online advertisement, collection of flash banner templates. Custom banner design service, also featured playable, interactive flash banners.
flash banner, flash banners design, flash logo, Banner Design for online advertisement, web banner d esign, banner design, banner design templates, Flash and GIF Banner Design, Interactive Banners, Log o Design, Button Design, Flash Intros, Flash Website Design, Standard flash Banner, Skyscraper,Small Rectangle Banner, medium rectangle banner, Leaderboard, custom banner design, customizable banners
banner, website, templates, design, builder, gallery, interactive, banner, banners, software, templa tes, design, required, software, banners, interactive, online, samples, calendar, template, custom, player, customizable, gallery, customization, services, marketing, 728x90, advertising, development, rectangle, attract, specialize, bannerserver, create, contact, a4desk, intros, please, intros, sele ct, playable, feature, different, clients, 160x300, skyscraper, 120x600, 300x250, 468x60, leader
bannerserver.com - rank der domain 620839 (11497 in IN)
Computers/Graphics/Web
zum Seitenanfang ↑
Thai Link Exchange
Welcome to the ThaiLE.com
http://www.thaile.com/
บริการแลกเปลี่ยน banner ฟรีพร้อมสถิต, บริการบริหาร banner บนเว็บของคุณ
ThaiLE.com - no.1 banner exchange network in thailand
thai,banner,exchange,ranking,promote,website,promote website, exchage banner
googeek, thaile, january, saturday, welcome, column, updated, monday, thunderbird, outlook, gallery, googeek, copyright, directorybanner, member, wrapper, mainnav, content, footer, margin, navigation, rightcollapsedefault, container, excludemodules, feature, second, hostpacific, header
(SLD : thaile.com)
World/Thai/คอมพิวเตอร์/อินเทอร์เน็ต/ออกแบบเว็บและการพัฒนา/โปรโมทเว็บไซต์
zum Seitenanfang ↑
Top Suchaufträge:

alle Kategorien

 - 

humor

 - 

auto

 - 

chat

 - 

handy

 - 

erotik

 - 

telefonbuch

 - 

job

 - 

flug

 - 

digitalkamera

 - 

lack

 - 

software

 - 

billigflug

 - 

notebooks

 - 

horoskop

Alle Rechte vorbehalten. Copyright refertus.info 2010. Für weitere Informationen lesen Sie unseren Haftungsausschluss. Webhosting