| Conscious Singles |
| Conscious Singles : Community, Dating and Support for Like Minded Singles |
| http://conscioussingles.com/ |
| Personal ads for singles of all sexual orientations who are interested in holistic living, spiritual ity, metaphysics, recovery, social issues and the environment. |
| Working on Yourself? Spriritual Practices? Holistic? Personal Growth? Single? |
| Spiritual singles, spiritual dating, spiritual single, spirit single, spiritual online dating, consc ious dating, spiritual personals, metaphysical dating, spirit singles, yoga singles, new age dating, new age singles, spiritual gay dating, spiritual gay singles, spiritual lesbian dating, spiritual l esbian singles, [law of attraction] dating, spiritual dating UK, spiritual dating Australia, spiritu al dating Canada |
| conscious, singles, support, conscious, difficult, singles, environment, website, single, partnered, discussion, really, various, approaches, dating, become, healthy, always, support, members, gracefu l, spiritual, community, beloved, search, difficutly, process, either, getting, meeting, manifesting , others, authors, becoming, workon, selected, minded, trying, possible, astute, spirituality, psych ology, western, eastern, assist, attraction, single, guidelines, conscioussingles, rights, reserved |
| (SLD : conscioussingles.com) |
|
| zum Seitenanfang ↑ |
| Science Connection |
| |
| http://www.sciconnect.com |
| Personal ads for science professionals and others with an interest in science or nature. |
| Singles group for science and nature enthusiasts |
| science singles, science dating, dating, singles, Science
Connection, sciconnect, personals, nature, science professionals, relationship, specialized, romance,
love, meet |
| members, connection, member, science, science, single, information, business, natural, members, numb ers, profiles, contact, photos, nature, contact, directly, involves, filling, joining, choose, detai ls, access, activities, outdoor, history, birding, verdana, depending, normal, opposite, minute, cop yright, memberlogin, 3071981, urchintracker, reserved, rights, standard, supply, reasonable, members hip, available, expect, maintain, civility, organization, distinguished, crowded, forbes, magazine |
| (SLD : sciconnect.com) |
|
| zum Seitenanfang ↑ |
| The Right Stuff |
| The Right Stuff |
| http://www.rightstuffdating.com/ |
| Dating service for graduates of renowned colleges and universities. Proof of graduation from a liste d school is required for registration. |
| |
| |
| dating, recommended, privacy, policy, screen, resolution, designed, forgot, javascript, enabled, bro wser, password, password, website, contact |
rightstuffdating.com - rank der domain 961076 (16173 in CA)
|
|
| zum Seitenanfang ↑ |
| Society/Relationships/Dating/Personals/Specialized |
|
|
| Society/Relationships/Dating/Personals/Specialized |
| zum Seitenanfang ↑ |
| AstroMate |
| AstroMate - Matchmaking and Online Dating |
| http://www.astromate.com/ |
| Matchmaking service that uses member's date and place of birth to create an astrological profile, th en finds potential matches. |
| |
| |
| astromate, astrology, offers, partner, astrological, profile, contact, viewing, possible, copyright, astromate, opportunity, information, astroservices, reserved, possibilities, compatibility, wealth, rights, support, please, although, written, forward, straight, before, comments, screen, questions, simple, narrows, featuresfaqenter, theastrolounge, tourupcoming, storiestake, dayssuccess, welcome, designed, heaven, service, receive, dating, matchmaking, online, members, member, accuracy, complet e, further, specified, criteria |
| (SLD : astromate.com) |
|
| zum Seitenanfang ↑ |
| Positive Personals |
| POZ - POZ Magazine - POZ.com - Personals - Dating - HIV - AIDS - HIV AIDS |
| http://www.positivepersonals.com/ |
| Personal ads for HIV+ men and women. All services free. |
| POZ Personals is the fastest growing online community for HIV positive dating. |
| POZ Personals, Dating, Friendship, Relationships, Sex, Sexual, HIV, AIDS, Heterosexual, Homosexual, Straight, Gay |
| personals, online, comments, health, premium, members, treatment, directory, messages, dynamic, sear ches, forums, content2, dynamicdrive, services, subscribe, calendar, coverage, events, positive, sea rch, recent, flirts, currently, script, strong, conference, positive, condoms, features, african, cu rrent, counter, profile, people, sending, bookstore, surveys, listings, american, widgets, community , latino, exclusives, status, getmainhub, menu2a, menu1a, community, testing, stories |
| (SLD : positivepersonals.com) |
|
| zum Seitenanfang ↑ |
| Gothic Personals |
| Welcome to Gothic Personals! |
| http://waningmoon.com/gothicpersonals |
| Personal ads for friendship or romance, targeted to the Gothic/alternative community. All services f ree. |
| |
| |
| personals, gothic, anything, profiles, romance, members, detailed, others, classifieds, welcome, sea rch, female, couple, background, within, dedicated, community, fostering, ourselves, seeking, furthe r, activity, membership, partner, sanctuary, safely, privately, change, between, romance, friendship , quizes, confidential, gallery, worldwide, safety, confidentiality, guidelines, instructions, membe rship, contact, register, account, logout, support, features, unlike, access, provide, designed, ser vices |
waningmoon.com - rank der domain 984500 (409661 in US)
|
|
| zum Seitenanfang ↑ |
| Country Singles Online |
| |
| http://www.countrysinglesonline.com/ |
| Personal ads for singles who value country life. Includes country events, country recipes, ideas for country weddings. |
| |
| |
| |
| (SLD : countrysinglesonline.com) |
|
| zum Seitenanfang ↑ |
| Chinese Astrology Matchmaker |
| Matchmaker, Dating, Marriage, Matchmaking, Love and Compatibility |
| http://chinesefortunecalendar.com/matchmaker.htm |
| Computer matches based on several different Chinese astrology fortune-telling systems. |
| Matchmaking, Dating, Marriage and Compatibility for perosnals relationship |
| Matchmaking,Dating,Marriage,Matchmaker,love,lover,Compatibility,Valentine,Day,Age,husband,wife,match ,personality,maker,Perfect,Score |
| compatibility, chinese, marriage, method, fortune, western, matchmaker, result, horoscope, methods, person, compatibility, dating, second, fortune, matches, people, matchmaking, entertainment, gender, individuals, please, matter, easily, astrology, personality, valentine, sharing, download, sensitiv e, serious, professionals, calendar, opinion, comparison, telling, traditional, compatible, birthday s, persons, analysis, multiple, scores, birthdays, tickle, dating, online, matchmakers, matchmaking, compatible, provides |
chinesefortunecalendar.com - rank der domain 105111 (40421 in US)
|
|
| zum Seitenanfang ↑ |
| Society/Relationships/Dating/Personals/Specialized |
|
|
| Society/Relationships/Dating/Personals/Specialized |
| zum Seitenanfang ↑ |
| Spirit Singles |
| |
| http://spiritsingles.com/ |
| Personal ads for singles interested in personal growth, spiritual growth, and a healthy lifestyle. I ncludes chat, online magazines, astrology, related products for sale. |
| |
| |
| |
spiritsingles.com - rank der domain 895804 (380964 in US)
|
|
| zum Seitenanfang ↑ |
| H-Friends |
| www.HFriends.com - Disabled Singles Dating Site |
| http://www.hfriends.com |
| Personal ads for singles with disabilities. |
| Dating site for singles with disabilities. |
| Disabled, Disability, Special Needs, Paralyzed, Amputee, Blind, Deaf, disabled singles, disabled dat ing, marriage, love, romance, friends, chat, blog, groups, events |
| female, disabled, dating, search, someone, singles, gajshost, document, pagetracker, disability, mem bers, disabilities, prospects, singles, dating, username, hfriends, groups, jayjayhot, dsl143, gende r, moonsera, farouck3, profile, classifieds, immediately, featured, oxeggs, couple, featured, findin g, access, javascript, disabled, google, analytics, script, trackpageview, 8848853, gettracker, 3csc ript, unescape, copyright, region, powered, protocol, location, aspnetdating, country, included, upd ate |
| (SLD : hfriends.com) |
|
| zum Seitenanfang ↑ |
| Philanderers International |
| Extramarital Personals - Extramarital Affairs Information Website |
| http://www.philanderers.com/ |
| Personal ads for married people seeking an extramarital affair or relationship. |
| Philanderers International and Private Affairs is most comprehensive extramarital relationship infor mation and dating destination for married women and men. Find secret romance and rediscover lost pas sion with Private Affairs |
| cheating houswives,personals, casual, adult, sex, love, romance, secret, encounters, unfaithful, dat ing, erotic, chat, extramarital, relationships, secret lover |
| document, extramarital, rightclickerror, layers, married, onmousedown, mousedown, captureevents, see king, welcome, privateaffairs, affair, return, looking, function, website, information, personals, a ffairs, button, disabled |
philanderers.com - rank der domain 983911 (16698 in CA)
|
|
| zum Seitenanfang ↑ |
| Soulful Singles |
| Soulful Singles |
| http://soulfulliving.com/soulfulsingles/ |
| Personal ads for spiritually and conscious-minded singles. Includes chat room, advice column, articl es about relationships. |
| Welcome to Soulful Singles at SoulfulLiving.com! A New Online Community of Spiritually and Concsiou s-Minded Singles. Make a Soulful Love Connection! |
| soulful, singles, soulful singles, personals, personal ads, romance, spiritually minded, conscious-m inded, spirituality, spiritual singles, conscious singles, values, responsible singles, meeting, dat ing, love, relationships, connection, love connection, sacred love, soulful men, soulful women, alte rnative, friendship, pen pals, men seeking women, women seeking men |
| singles, soulful, present, moment, living, hearts, welcome, featuring, values, spiritually, communit y, online, conscious, minded, passionate, soulfulliving, singles |
soulfulliving.com - rank der domain 715162 (289586 in US)
|
|
| zum Seitenanfang ↑ |
| Spiritual Personals |
| |
| http://www.spiritualpersonals.org |
| Personal ads for singles who value spiritual life, particularly outside organized religion. All serv ices free. |
| |
| |
| astralhearts, please |
| (SLD : spiritualpersonals.org) |
|
| zum Seitenanfang ↑ |
| Spiritual Singles |
| |
| http://www.spiritualsingles.com |
| Personal ads for singles who value personal growth, the environment, holistic health. Includes chat, forums, audio and video clips. |
| |
| |
| |
spiritualsingles.com - rank der domain 107125 (41238 in US)
|
|
| zum Seitenanfang ↑ |
| Motorist Mail |
| Chat gratis Italia anima gemella incontri singles |
| http://www.motoristmail.com |
| Personal ads that provide search by license plate number. Enables members to contact other members t hey saw on the road. Both members must be registered by license plate number. |
| Chat con foto completamente gratis che permette di trovare la propria anima gemella online |
| anima gemella |
| incontri, gratis, italia, egrave, password, servizio, gemella, incontri, singles, ograve, amicizia, famoso, contattare, passare, utenti, registrati, quanto, diverse, vetrina, utente, dimenticata, onli ne, single, proximeety, annunci, acquista, recensioni, autoveicolo, international, televisioni, segn alato, teleroma56, documentati, giornali, inizialmente, entoni, amorevero, shokkante, marco33ok, dir ectory, italiana, recensioni, informazioni, iscrizione, maggiori, contatti, ilaria00, lillina, dinap oli, smsgirl, propria |
motoristmail.com - rank der domain 918889 (387421 in US)
|
|
| zum Seitenanfang ↑ |
| MeetYourGreens.com |
| Totally free online dating service. Find singles for matchmaking via personals... |
| http://www.meetyourgreens.com/ |
| Totally free personal ads for singles, no charges to contact other members. |
| Totally free dating service. Find love with hot men and hot women singles via our truly free online dating personals. Free personal ads. |
| totally free dating, totally free singles, completely free dating, completely free singles, 100% fre e dating, free dating, free matchmaking, free personal ads,hot guys, hot men, american men, 100% fre e singles,totally free personals,interracial dating |
| myform, dating, return, please, personal, function, people, address, mailflag, personals, singles, d ocument, members, indexof, looking, russian, dating, online, password, length, password, option, tot ally, totally, mature, service, spaces, membership, urlarray2, personals, contact, account, quality, completely, community, however, meetyourgreens, window, really, friends, height, status, passwd, re sizable, someone, addthis, create, american, scotland, scrollbars, winnerwidth |
meetyourgreens.com - rank der domain 846890 (316521 in US)
|
|
| zum Seitenanfang ↑ |
| Soul Weavers |
| www.soulweavers.com |
| http://www.soulweavers.com/ |
| Personal ads for singles interested in spirituality and personal growth. |
| |
| |
| selectedtld, margin, highlighted, function, google, browser, removeclass, background, images, addcla ss, padding, domainsearchad, tlddiv, srcharrowdiv, keycode, document, domain, highltd, height, versi on, search, repeat, length, weight, soulweavers, return, srcharrow1, secureserver, availtlds, slctdt ld, bottom, position, srcharrow2, domain, divbase, maincontent, domainpromo, location, entered, resp onse, domainnameinput, mrktinglnks3, search, pointer, window, domaintocheck, select, tldshown, curso r, bluelink, 0000ff |
| (SLD : soulweavers.com) |
|
| zum Seitenanfang ↑ |
| 10Karats (Herpes) |
| |
| http://www.10karats.com/ |
| Personal ads for singles with genital herpes (HSV) and genital warts (HPV). Includes social events, HSV links and resources. |
| |
| |
| pagetracker, document, gajshost, script, javascript, 678732, trackpageview, gettracker, location, pr otocol, unescape, 3cscript, analytics, google |
| (SLD : 10karats.com) |
|
| zum Seitenanfang ↑ |
| Single Non Smokers Introductions |
| Internet dating service for single nonsmokers A members only dating service. |
| http://www.together.net/~sniusa |
| Personal ads for nonsmokers or smokers seeking to quit. |
| THE INTERNET DATING SERVICE for Non Smokers Dating Personals Matchmaker Nationwide Members Only Roma nce Connection for Respectable and Sincere Singles! |
| internet dating service, dating service, 603-256-8686, xoobis, FOCACA, focaca, Single, nonsmokers, D ating, matchmaker, dating men, Meeting, meeting new people, Romance, Single Nonsmokers, single nonsm okers, sniusa, romance, love, personal ads, women, Single, Members Only, members only, SINGLES, Memb ers, dating ladies, membership, sincere, DATING, Singles Connection, bachelor, batchelorette, christ ian, classified, classifieds, connection, companionship, happiness, hearts, jewish, lifetime, men, n onsmoker, nonsmokers, NONSMOKERS, nonsmoking singles, NONSMOKIING SINGLES, partner, partners, person al, personals, relationship, romantic, services, sexual, sexy, single, singles, social, people, cour tship, on-line dating, on line dating, internet dating, flirting, free personals, success stories, s pouse, www.together.net/~sniusa, bnsingle.com, |
| single, nonsmoking, single, nonsmoker, nonsmokers, singles, service, members, membership, dating, pl ease, little, together, membership, internet, between, dating, thanks, service, sample, children, lo oker, blonde, parachute, magazine, member, information, something, things, correspond, worked, pleas e, application, classic, weight, myself, consider, smokers, lifetime, consists, another, relationshi p, searching, internet, sniusa, definitely, general, designed, hobbies, mexico, wishes |
| (SLD : together.net) |
|
| zum Seitenanfang ↑ |
| Women Behind Bars |
| Womenbehindbars free personals female inmates |
| http://www.womenbehindbars.com/ |
| Personal ads for female inmates. Contact by postal mail only. |
| Womenbehindbars hosts free legal ads and personal ads with pictures for female inmates who are priso ners, throughout the country, in every state, and county that desire penpals. |
| Womenbehindbars,women, prison, bars, female, pen, pals, penpals, woman,inmates |
| ladies, questions, warnings, subscribe, updates, people, release, endings, contact, female, personal s, womenbehindbars, inmates, newest |
womenbehindbars.com - rank der domain 997384 (408819 in US)
|
|
| zum Seitenanfang ↑ |
| Peer 2 Peer - Networking for Geeks |
| Peer 2 Peer - Personals for Geeks |
| http://personals.ufies.org/ |
| Personals site dedicated to those of an intellectual and technical disposition. Ads include dedicate d space for Geek Code. |
| |
| user friendly,romance,love,dating,personals,geeks,computer,geek,passion,dust puppy,ufies,relationshi p,personal,networking,perl,matchmaker,Iambe, Arcterex, Garden Variety Goddess, Intimate & Interactiv e |
| personals, questions, regarding, better, search, people, sooner, companion, personals, programming, copyright, around, someone, dreams, finding, personal, create, pretenses, completed, yourself, field s, submission, submit, instructions, rocket, perfect, looking, slaves, submitting, network, drivers, special, simple, device, follow, correct, userfriendly, content, arcterex, please, conditions, repo rts, anything, expressions, characters, illiad, permission, userfriendly, excepted, graphics, owners |
ufies.org - rank der domain 999724 (16533 in CA)
|
|
| zum Seitenanfang ↑ |
| Herpes Date |
| |
| http://www.herpes-date.com |
| Personal ads for singles with herpes and other sexually transmitted diseases. Includes links to herp es information. All services free. |
| |
| |
| pagetracker, document, gajshost, script, javascript, 678732, trackpageview, gettracker, location, pr otocol, unescape, 3cscript, analytics, google |
| (SLD : herpes-date.com) |
|
| zum Seitenanfang ↑ |
| Harley-Match |
| Harley-matcH.com-Biker Personals-dating and motorcycle events |
| http://www.harley-match.com |
| Personal ads for bikers and motorcycle enthusiasts. Includes events listing, biker links, classified s to buy and sell motorcycle parts. Veterans always free. |
| Biker Personals and harley dating brings romance for those
that love to ride. Daytona Bike Week an d motorcycle events, biker babes, biker chicks
and single bikers join Harley-matcH |
| biker babes, biker dating, biker personals, biker date, biker kiss, motorcycle events, daytona bike week, dating, who invented the motorcycle, biker girls,
biketoberfest, easy rider, biker links, po ker run, female biker personals, women motorcycle riders,
women on wheels, harley personals, leath er jackets, leather chaps, leather motorcycle chaps, women's leather chaps,
used motorcycles, wome n bikers, cyclematch.com, cycle-match.com, custom bikes, women riders,
dating service, biker match making, choppers, divorce chat, harleymatch.com, harley-match.com,personals for bikers,
sturgis pi cs, bike week, laconia, laughlin, harley girls, daytona bike week,motorcycles,
motorcycle classifi ed, motorcycle events, adventure personals, motorcycle enthusiasts, biker links, motorcycle parts,
motocycles, chopper, sportbikes, sturgis rally, biker chicks, biker, biketoberfest, myrtle beach bi ke week |
| harley, document, images, slideshow, couple, blendtrans, preload, slideshowspeed, personals, harleym atch, reserved, rights, matchsm, function, dating, harleymatch, duration, network, forgot, profile, davidson, password, filters, filter, blockerror, member, contact, runslideshow, crossfadeduration, e vents, riders, friends, riders, codelifter, welcome, motorcycledating, harleymatch, cyclematch, memb ers, motorcycle, disclaimer, information, product, disclaimer, people, classifieds, codelifter, addi ng, motorcycle, affiliates, affiliated |
| (SLD : harley-match.com) |
|
| zum Seitenanfang ↑ |
| Single Firefighters |
| singlefirefighters.com | Firefighter Personals | Single Firefighters |
| http://www.singlefirefighters.com |
| Singles personals for firefighters and people looking to date firefighters. |
| |
| |
| dating, republic, members, single, states, pierre, miquelonsaint, helenasaint, nevissaint, vincent, luciasaint, leonesingaporeslovakiasloveniasolomon, former, arabiasenegalseychellessierra, principesa udi, marinosao, yugoslav, islandspolandportugalpuerto, mariana, islandsnorwayomanpakistanpalaupalest inian, territory, islandnorthern, zealandnicaraguanigernigerianiuenorfolk, caledonianew, ofmoldovamo nacomongoliamontserratmoroccomozambiquenamibianaurunepalnetherlandsnetherlands, federated, islandsso maliasouth, guineaparaguayperuphilippinespitcairn, antillesnew, ofmadagascarmalawimalaysiamaldivesma limaltamarshall, occupiedpanamapapua, islandsmartiniquemauritaniamauritiusmayottemexicomicronesia, r icoqatarreunionromaniarussiarwandasaint, gambiatogotokelautongatrinidad, firefighter, futunawestern, online, fighters, adventure, islandswallis, islandsuruguayuzbekistanvanuatuvenezuelavietnamvirgin, lankasudansurinamesvalbardswazilandswedenswitzerlandsyriataiwantajikistantanzaniathailandthe, bahama sthe, southkuwaitkyrgyzstanlaoslatvialebanonlesotholiberialibyaliec |
| (SLD : singlefirefighters.com) |
|
| zum Seitenanfang ↑ |
| Compatible Relationships |
| Compatible Relationships |
| http://www.compatiblerelationships.com |
| Purchase a compatibility report based on the energy exchanged between two individuals including frie nds, lovers, family members, and celebrities. |
| An easy way to find your Soul Mate, Compatible Relationships will determine the likely outcome of yo ur relationships using the Dana Catalano unique Compatiblity Report System that scores the energy ex changed between you and the other person using birth date information not zip codes. Use our easy on line dating service that searches and selects only people who are compatilbe with you. |
| soul mate search, personal compatibility report, compatiblity test, birth companion report, celebrit y photos, celebrity pics, celebrity compatibility, Dana Catalano celebrity predictions, relationship advisor, relationship advice, relationship expert, dating service, dating site, online dating, onli ne dating service, love, romance, relationship, friendship, personal ad, Christina Aguilera, Jude La w, Ben Affleck, Britney Spears, Jennifer Lopez, J.Lo, Jennifer Aniston, match, matchmaking, matchmak er, match maker, single, people, date, dating, quality, upscale, successful, women, men, partner, je wish, christian, christian date, christian singles, christian dating service, christian dating, spir itual, religious, commit, long term, exclusive, matching, sensitive, nice, sexy, smart, single paren t, dating, advice, tip, companion, marriage, divorce, widow |
| compatible, celebrity, personal, compatibility, dating, report, member, favorite, relationships, wei ght, reports, special, someone, family, knowles, relationship, before, contacting, relationship, bey once, lawmavin, compatibility, members, register, companions, reports, compatibly, obligations, ff00 00, required |
| (SLD : compatiblerelationships.com) |
|
| zum Seitenanfang ↑ |
| Recoveringmates.com |
| Recovering mates, A Dating Site for Singles in All Types
of Recovery- Recoveringmates.com |
| http://recoveringmates.com |
| For singles in all types of recovery including alcoholism and addiction, grief, loss, and other reco very related issues. |
| Recoveringmates.com - A very unique dating site in recovering mates
& welcomes all types of recover y |
| Recovering mates, recovering singles, meet other singles in
recovery, meet other sober singles, rec overy websites, alcohol addiction
recovery, meeting recovering people, sober websites, sober dating sites,
dating service, internet dating services,sober and single,friends of bill
w,sober,recoveri ng,aa,na,alanon, sober, overeaters, 12-Step
Dating,recover,recovering,clean and sober,dating men,da ting woman,internet
dating,online dating recovering adults, sober fun, recovering men and woman,
o nline chat,free,free membership,free dating,free online dating,soberrecovery,sober,soberdates,sober dating,aameetings,aa,na,nameetings, aa meetings, na
meetings, recovering groups, sober groups, kee pitsimpledating, soberandsingle |
| singles, dating, carolina, dakota, simple, recoveringmates, online, virginia, recovery, recovering, female, location, recoveringmates, window, database, friend, largest, access, copyright, values, mov ement, lifestyle, premiere, features, special, enterprises, artemis, welcome, service, provides, rep ort, disclaimer, started, violations, wrongdoing, guidelines, membership, safety, privacy, romance, marriage, affiliates, seeking, search, healthy, relationship, seeking, choose, password, forgot, mem ber |
| (SLD : recoveringmates.com) |
|
| zum Seitenanfang ↑ |
| Sober and Single |
| Soberandsingle.com - Your Sober Community for Dating Personals |
| http://soberandsingle.com |
| Personal ads for singles who want an alcohol-free relationship. |
| Sober and Single is an online dating service that helps you meet new friends, partners, even a love interest. Chat with sober singles looking for alcohol and drug free companions. |
| singles in recovery, sober and single, sober dating, sober living, sober singles, women for sobriety , men for sobriety, recovering singles, drug free singles, drug free dating, clean and sober, clean and sober dating, alcohol free singles, alcohol free dating, sober partner, aa singles, aa dating, n a singles, na dating. |
| element, eventobj, toggle, single, dating, previous, function, singles, female, search, select, sobe randsingle, username, gender, return, seeking, checkel, profile, romance, location, document, elemen ts, highlightcolor, submit, backgroundcolor, personals, highlight, dating, intended, singles, greate r, internet, website, profile, looking, someone, alcohol, relationship, members, checked, logins, de pends, import, parentnode, function, password, bookmarkurl, bookmarktitle, subdomains, spiritual, sm oking |
soberandsingle.com - rank der domain 981893 (66609 in DE)
|
|
| zum Seitenanfang ↑ |
| Two for the Show |
| Untitled Document |
| http://www.twofortheshow.com |
| Personal ads for singles interested in arts and entertainment events. Members list shows they're int erested in, then find others interested in the same shows. |
| |
| |
| closed, support, untitled, document |
| (SLD : twofortheshow.com) |
|
| zum Seitenanfang ↑ |
| Spiritual Romance |
| Spiritualromance.com - Dating Personals for Spiritual Singles |
| http://www.spiritualromance.com |
| Meet people whose common bond is their desire to date others who share a spiritual state of mind. |
| Spiritual Romance is an online dating service with free personals for singles looking for a spiritua lly like-minded partner. Search our large network of like-minded singles. |
| Christian dating, Christian singles, Christian personals, Christian romance, Christian partner, spir itual dating, spiritual singles, spiritual personals, spiritual romance, spiritual partner, Faith ba sed dating. |
| eventobj, element, toggle, spiritual, dating, previous, singles, function, spiritual, dating, romanc e, search, spiritualromance, select, elements, username, profile, checkel, return, location, gender, seeking, document, female, submit, personals, backgroundcolor, singles, romance, spiritualism, high light, highlightcolor, intended, depends, profile, looking, relationship, wellness, christian, check ed, bookmarktitle, bookmarkurl, greater, members, logins, import, parentnode, function, password, su bdomains, charleston |
| (SLD : spiritualromance.com) |
|
| zum Seitenanfang ↑ |
| Love Connection Wireless Dating |
| |
| http://wldating.com |
| Photo ads via wireless cell phone. Requires 2.5G or 3G cell phone with a WAP browser and ability to upload color JPG photo. |
| |
| |
| |
| (SLD : wldating.com) |
|
| zum Seitenanfang ↑ |
| Military Date |
| Military Singles - Military Personals - Military Dating - A Dating Site for U.S. Military Singles and Civilians looking to meet Military Singles. Meet Military Men and Women Online Now. MilitaryDate.com |
| http://www.militarydate.com |
| Personal ads for singles in the military or looking to meet someone in the military. |
| Navy, Marines, Army, Air Force, Coast Guard, meet single military personnel. Place your ad for FREE or browse ads for that special someone. Search by branch, base, rank, etc. |
| military singles, military dating, single military, military personals, army, air force, navy, marin es, marine corps, coast guard, enlisted, commissioned, rank, officers, military installations, singl es, military, personals, personal ads, online dating, date military men, date military women |
| military, islands, singles, island, dating, republic, military, guinea, united, militarydate, lookin g, someone, french, decoration, zealand, nigeria, nicaragua, norfolk, panama, pakistan, norway, para guay, calidonia, arabia, seychelles, sierra, slovakia, singapore, saipan, rwanda, puerto, portugal, poland, philippines, russia, romania, reunion, mauritania, liberia, lesotho, lebanon, latvia, lithua nia, macedonia, luxembourg, kyrgyzstan, jordan, jamaica, kazakhstan, kuwait, kiribati |
| (SLD : militarydate.com) |
|
| zum Seitenanfang ↑ |
| Dating for Smokers |
| Datingforsmokers.com - Your Dating Community for Smokers |
| http://www.datingforsmokers.com/ |
| Personal ads for singles who smoke. |
| Dating for Smokers is an online dating service with free personals for singles that smoke. Thousands of sincere personal ads currently listed in our date finder search. Lets find you a life partner. |
| smokers rights, sexy smokers, smoker, dating for smokers, single smokers, smoking allowed. |
| dating, eventobj, element, toggle, function, select, smokers, previous, smokers, search, datingforsm okers, singles, seeking, elements, location, profile, checkel, return, female, gender, username, doc ument, smoking, submit, singles, backgroundcolor, romance, dating, intended, highlight, highlightcol or, rights, members, internet, depends, website, greater, checked, profile, relationship, seeking, i mport, logins, password, bookmarkurl, function, personals, subdomains, parentnode, bookmarktitle, so meone |
| (SLD : datingforsmokers.com) |
|
| zum Seitenanfang ↑ |
| Country Western Singles |
| Country Western Singles. Join to find dates, dancing partners and friends. |
| http://www.cwsingles.com |
| Personal ads for singles who enjoy country music and the country lifestyle. |
| Country Western Singles dating to meet single horse lovers, cowboys, cowgirls, ranchers and farmers who enjoy country music, and the country lifestyle. Find Riding buddies,dancing partners, romance, a nd equestrian dating. |
| Country Singles, Dating, Match Making, Equestrian Cupid, Date Cowboy, Date Cowgirl, Horse Lovers, Si ngles Dating, Online Dating Service, Equestrian Singles, Equestrian Dating, Riding Buddies |
| location, community, parent, friends, busted, partners, dancing, lively, country, western, equestria n, friendship, buddies, riding, romance, memory, articles, contact, success, stories, security, affi liates, advertising, premium, experience, specials, upgrade, summer, stories, membership, invite, re quire, features, javascript, cookies, enable, 9c9c9c, country, indexof, frames, western, singles, bo rder, browser, networking, featured, social, leader, boasts, equestriansingles, winfrey |
| (SLD : cwsingles.com) |
|
| zum Seitenanfang ↑ |
| Date to Play |
| |
| http://www.datetoplay.com |
| Personal ads for men and women looking for someone to share common interests, such as cooking, joggi ng, and opera. Members can seek platonic or romantic relationships. |
| |
| |
| |
| (SLD : datetoplay.com) |
|
| zum Seitenanfang ↑ |
| HDate |
| Welcome to HDate ! |
| http://www.hdate.co.uk |
| A UK-based service for people with herpes. |
| A UK based introduction service for those wishing to get in touch with others with Herpes. |
| Herpes, UK, U.K., introduction service, dating, herpes dating, HSV dating, England, personal, person als, ads, personal ads, friend, herpes simplex virus, herpes dating services |
| frames, welcome, supports, browser, download, shortly, please, service, dating, really, herpes |
| (SLD : hdate.co.uk) |
|
| zum Seitenanfang ↑ |
| Golfmates.com |
| |
| http://www.golfmates.com |
| Personal ads for golfers. |
| |
| |
| |
golfmates.com - rank der domain 981756 (402322 in US)
|
|
| zum Seitenanfang ↑ |
| Hep C Match |
| HepCMatch Dating With Hepatitis C Hep C |
| http://www.hepcmatch.com/ |
| Personal ads for men and women living with Hepatitis C. |
| Dating Site For People With Hepatitis C Or Hep C |
| hepatitis c,hepatitis,hepatitis b,hepatitis a,hepatitus,dating,dating site,meet people,singles,suppo rt group,hep c dating, hepatitis c singles, hep c singles, hepatitis c dating, matchmaking, hepatitu s, hcv, interferon, hep-c, chronic hepatitis, hepatitus c, cure, treatment, intron, virus, treatment , symptoms, pegintron, peg intron, pegylated intron, singles |
| hepatitis, dating, singles, female, search, living, around, looking, someone, exactly, gender, gener al, things, people, friend, gajshost, adults, single, support, hepcmatch, document, community, profi les, location, photos, through, partner, simple, pagetracker, understands, active, locally, experien ces, whether, rewarding, social, waiting, further, invite, decide, anonymous, become, companion, int eractive, hoping, global, member, online, looking, california, southern |
| (SLD : hepcmatch.com) |
|
| zum Seitenanfang ↑ |
| Country Connections |
| Country Connections Web site |
| http://www.countryconnections.org/ |
| Newsletter-based personal ads for singles in rural areas. |
| Country Connections is a newsletter and Web site designed as a way for single people in rural areas to meet other single people with similar interests. |
| Country Connections, rural singles, online dating, personal ads, meet people, country, single |
| family, verdana, ffc200, bottom, 000000, active, decoration, visited, ffffff, ffffff, b32c02, helvet ica, weight, margin, country, connections, ffc200 |
| (SLD : countryconnections.org) |
|
| zum Seitenanfang ↑ |
| Date A Little |
| www.DateALittle.com - Dwarf Dating, LP Dating, and Short Stature Dating |
| http://www.datealittle.com/ |
| Personal ads for Little People and those with any of the various forms of Dwarfism. |
| A dating site for LP singles (Little People). We have members with all types of dwarfism such as Ac hondroplasia, Diastrophic Dysplasia, Spondyloepiphyseal Dysplasia, and more. |
| dwarf, dating, single, marriage, dwarfism, achon, achon, Achondroplasia, friends |
| dating, female, dating, singles, members, dwarfism, membership, featured, featured, search, document , username, pagetracker, profile, datealittle, gajshost, gettracker, little, people, successes, jess ica, padilla2437, channel, marriage, trackpageview, stature, completely, create, 8848853, finally, u nescape, region, country, 3cscript, powered, location, protocol, copyright, couple, google, jlefebvr e, aspnetdating, dale101, script, michael, analytics, gender, javascript, canada, forgot, password |
| (SLD : datealittle.com) |
|
| zum Seitenanfang ↑ |
| My Dance Friends |
| mydancefriends.com dance community |
| http://www.mydancefriends.com/ |
| Personal ads for singles interested in dancing. Includes discussion boards and links to related reso urces. |
| |
| |
| function, return, arguments, swindowoptions, invite, reject, iheight, iwidth, server, owindow, scree n, height, irealheight, irealwidth, dancescape, privacy, videos, swindowname, members, update, savea lbumtitle, savealbumdesc, saveimagetitle, cities, states, xajaxloaded, countries, saveimagedesc, win dow, nekko28, trixie, khalid, sicilianbabe, account, messenger, instant, gallery, favorites, matchin g, voting, constitutes, respective, owners, acceptance, policy, initajax, conditions, property, copy right, contact, uploaded |
| (SLD : mydancefriends.com) |
|
| zum Seitenanfang ↑ |
| CowboyCowgirl |
| CowboyCowgirl.com - Cowboy Cowgirl Country Singles Online Dating |
| http://www.cowboycowgirl.com |
| Personal ads for singles who like the country way of life. |
| Cowboy Cowgirl Online Dating. Join thousands of singles that share your love for the country way of life. FREE Profile! |
| date,dating,personals,singles,cowboy,cowgirl,match,country,farm,farmer,ranch,rancher,horses,horse,ro deo,western,equestrian,online,profile,photo |
| basicsearch, decoration, seekinggender, gender, century, gothic, verdana, family, selected, navtext, cowboy, attributename, minoption, country, cowgirl, online, footerlink, maxoption, options, 6a7188, document, people, function, dating, singles, online, cowgirls, looking, horses, gajshost, pagetrack er, should, cowboys, profile, create, optionobject, cowboycowgirl, background, repeat, visited, sing les, object, number, enjoyed, contry, friend, western, people, ranchers, farmers, protocol |
| (SLD : cowboycowgirl.com) |
|
| zum Seitenanfang ↑ |
| International House of Wives |
| extramarital affairs - searchable married personals. |
| http://www.i-how.org |
| Personal ads for married men and women looking to cheat on their spouses. |
| We can help you have extramarital affairs, we are a married personals site looking for cheating husb ands to satisfy our wives. |
| extramarital affairs, cheating husbands, married personals, married but looking,cheating,infidelity, wife,husband,wives,and flirting,looking,lonely,discreet,discrete,story,spouses,spouse,sex,married bu t lonely,married and cheating,wive,wife,wives,wifes,hot,slut wife,nude,cheating,husband,hubby,husban ds,extra-marital affair,extra,marital,flirting,discreet affair,one night stand,no-strings,swinger,ph ilanderer,adultery,adulterer,EMR,EMA,extra marital,people,personals, married sex,dating,swinging wiv es,personal,photo,photos,adult webmasters,dating webmasters,dating affiliates,adult affiliates, |
| personals, married, extramarital, affairs, searchable |
| (SLD : i-how.org) |
|
| zum Seitenanfang ↑ |
| AfterH |
| www.AfterH.com - Herpes Singles and HPV Singles Dating Site |
| http://www.afterh.com/ |
| Personal ads for singles with herpes (HSV) or genital warts (HPV). Includes list of support groups b y state, recommended books and videos. |
| Herpes Dating site for singles with Herpes ( HSV ) or Genital Warts ( HPV ). |
| Herpes, Warts, Herpes Singles, HSV, HPV, STD, Love, Romance, Marriage, Free Trial, Events, Groups, C hat, Herpes Chat, STD Singles, HPV Singles |
| herpes, singles, singles, groups, people, features, username, document, statistics, gajshost, simple x, usually, pagetracker, thousands, dating, herpes, search, nothing, telling, someone, understands, everyone, million, javascript, analytics, 3cscript, google, script, trackpageview, 8848853, gettrack er, unescape, americans, genital, genitally, orally, papillomavirus, copyright, protocol, location, powered, aspnetdating, register, couple, country, region, b72c793cff7fc1e2858d97362236ca13, remember , computer, password, facebook |
| (SLD : afterh.com) |
|
| zum Seitenanfang ↑ |
| Loving Links |
| Loving Links extramarital dating site for married people |
| http://www.lovinglinks.co.uk/ |
| Adverts for people seeking extra-marital affairs. Bulletin board and media articles. |
| Married dating website and consultancy service for attached men and women to arrange an extramarital affair |
| Adultery, extra-marital,married dating,dating for married people, affair, philanderer, mistress, sec ret affair, unfaithful, a bit on the side, adulterous relationship, nookie, lover, sex, illicit, ho usewife, extra-marital lover, playing away from home, a bit of nookie, Discreet relationship, swinge rs, infidelity, Discreet |
| dating, married, affair, loving, service, premium, female, looking, document, se9bw2, extramarital, pagetracker, london, discreet, people, search, relationships, members, marital, membership, genuine, thousands, discreet, testimonials, yourself, around, instant, gajshost, unique, articles, attached, script, se9bw2s, interactive, password, midlands, location, javascript, protocol, providesupport, c ontact, profiles, quality, friendly, discuss, personals, requirements, hesitate, organisation, lovin g, account |
lovinglinks.co.uk - rank der domain 811247 (26015 in GB)
|
|
| zum Seitenanfang ↑ |
| Astral Hearts |
| Astral Hearts - Metaphysical Personals |
| http://astralhearts.com/ |
| Personal ads for metaphysical-minded people. Portion of profits goes to charitable causes. |
| Personal ads for metaphysically-minded people. |
| personals,classifieds,dating,friends, spiritual,metaphysical,twinflame,soulmate,astrology, romance,l ove,yoga,meditation,vegetarian,vegan |
| astral, hearts, document, people, welcome, success, stories, articles, membership, profile, emails, dating, script, similar, metaphysical, topics, spirituality, desire, internet, finding, minded, meta physician, master, interest, mainstream, flames, itwebz, rights, reserved, someone, really, service, alternative, because, personally, created, partner, please, romance, difficult, single, looking, in terests, search, insertbefore, parentnode, getelementsbytagname, profiles, signup, wisdom, awards |
| (SLD : astralhearts.com) |
|
| zum Seitenanfang ↑ |
| Dating With H |
| DatingWithH.com - Herpes Personal Ads, Herpes Dating, Herpes Simplex Virus HSV, Human Papilloma Virus HPV, Genital Warts |
| http://www.datingwithh.com |
| Personal ads for men and women with herpes or Human Papilloma viruses. |
| Herpes Personal Ads, Herpes Dating (HSV), Genital Warts (HPV). |
| herpes dating, hsv, hpv, herpes personal ads, genital warts, mpwh |
| dating, herpes, people, genital, community, people, weight, 000000, verdana, messages, someone, simp lex, papilloma, create, personal, already, control, prevention, according, affects, homemortgage, ce nters, condition, global, disease, internet, privacy, information, realize, important, websites, unl ike, release, common, shared, personal, information, anyone, singles, communitywe, connecting, netwo rk, looking, connects, himatchmaker, topeoplewithherpes, datingwithh, account, happened, website, 43 7737 |
| (SLD : datingwithh.com) |
|
| zum Seitenanfang ↑ |
| Herpes dating |
| MPwH from Antopia! |
| http://www.mpwh.net/ |
| Monitored community for people with herpes, support, information and resources. Datingsite with over 50,000 members featuring chat, message boards, and personal ads. |
| Member Profiles, Picture Galleries, AV Chat, Message Boards, Games! Best herpes dating, hpv dating, and support, free to join! The Very Best Herpes Dating Service for People with Herpes and HPV. Come to MPwH.net for Herpes and HPV Dating and Friendships! MPwH offers Herpes Dating, Herpes Support, he rpes personals, and HPV personals, with dating and community services for people with Herpes and HPV , and services for Herpes and HPV Singles and Couples. |
| Herpes, best herpes dating, herpes dating, herpes singles, free herpes chat, people with herpes, dat ing with herpes, dating with HPV, people with HPV, free dating, free chat, herpes support, hpv suppo rt, free herpes personals, free HPV personals, Herpes dating, Herpes Pictures, Dating with herpes, H erpes personal ads, Dating with Herpes, Herpes personals, HPV personals, Dating with HPV, Herpes soc ial networking, HPV social networking, dating HPV, dating herpes, Meet people with herpes, Herpes Ad s, HPV pictures, HPV information, Herpes information, Herpes friends, HSV, HSV-1, HSV-2, HPV, LEEP, Genital warts |
| herpes, herpes, information, medical, community, people, dating, antopia, support, dating, internet, papilloma, treatments, support, online, thousands, mention, articles, virusthe, feature, latest, sc ientific, genital, someone, diagnosis, difficulty, having, toward, attitudes, social, simplex, artic le, member, information, biggest, online, trusted, active, romance, friendships, welcome, contact, c elebrating, service, privacy, yearson, anonymous, around, message, company, operates |
mpwh.net - rank der domain 306206 (120915 in US)
|
|
| zum Seitenanfang ↑ |
| SeniorsMatch |
| SeniorsMatch.com |
| http://wiredseniors.com/seniorsmatch/ |
| Personal ads exclusively for the over 50 age group. Profile search available with membership. |
| The Only Matching Service Exclusively For The Over 50 Age Group - Personals And Travel Mates |
| personals, personal ad, travel mate, travel mates, travel companion, travel companions, pen-pal, pen pal, single, singles, single seniors, single senior, friends, relationship, long-term relationship, long term relationship, senior citizen, adults 50+, adult seniors 55+, senior adults 60+, seniors h ealth, seniorsnet, elders, 50+travel, seniors exchange, aging, seniors travel discounts, grandpare nts, adult seniors tours |
| seniors, seniors, seniorsmatch, single, travel, relationships, seeking, window, lifestyle, dating, b rowser, location, exclusively, looking, travellers, person, internet, diverse, population, aspiratio ns, enrichment, through, reason, members, exchange, search, version, bulletin, christian, discount, helping, memorial, discussion, upgrade, digest, middot, copyright, viewing, frames, please, support, exactly, numerous, friends, companions, thousands, elders, grandparents, personal, retired, citizen s |
wiredseniors.com - rank der domain 813295 (330612 in US)
|
|
| zum Seitenanfang ↑ |
| Uniform Dating |
| Uniform Dating - Military Singles & Those Seeking a Date in Uniform |
| http://www.uniformdating.com/ |
| Dating site for the uniformed and emergency services, or those wishing to meet someone from the unif ormed services. Location based results search. |
| Uniform Dating - Want to meet Military singles, fire fighter singles, sexy nurse, police singles or a man in uniform? Dating for the uniformed and emergency services or those seeking a date in uniform . Interested Civilians welcome. |
| uniform dating,military singles,uniform,dating,military,military dating,military personals,gay milit ary,single military men,penpal military,police single,police singles,police dating,firefighter singl es, men in uniform,meet, |
| member, uniform, dating, maxlimit, images, verarr, flashver, uniformed, professions, javascript, fro ntpage, working, services, emergency, uniform, dating, looking, contact, enabled, service, health, f unction, countfield, ieversion, seeking, download, reqver, length, parsefloat, address, password, us eragent, counter, navigator, stories, success, update, enable, substring, browser, policy, otherwise , characters, privacy, uniformdating, created, someone, advice, members, encourage, welcome |
uniformdating.com - rank der domain 162917 (4749 in GB)
|
|
| zum Seitenanfang ↑ |
| Widows or Widowers |
| Widows or Widowers Dating Support Friendship |
| http://www.widowsorwidowers.com/ |
| Dating service for people that have lost their spouse. Search or browse members by location, FAQ, te rms and guidelines. |
| Conscientious support and dating service for widows and widowers. Contact widows or widowers for hel p through difficult loss experience. |
| widow and widower, widow support, widow help, widower support, widower help,dating a widower, wife o f widower, remarriage widower, dating a widow, senior dating site, senior single dating, senior chri stian dating, dating for senior citizen, online senior dating services, adult dating online service, mature adult dating, adult dating site uk, free adult dating uk, online personals adult dating, adu lt dating free online site, free internet adult dating, adult dating services uk, adult dating datin g site, online dating website uk, online single dating agency uk, online dating agency uk, widow b ride, second love chance, www.widowsorwidowers.co.uk,loss,grief |
| guinea, seeking, relationship, republic, united, friendship, rwanda, sweden, russia, suriname, polan d, philippines, romania, portugal, sierra, africa, somalia, slovakia, singapore, senegal, marino, sl ovenia, arabia, mauritius, mauritania, mexico, moldova, mongolia, monaco, maldives, luxembourg, mace donia, madagascar, malaysia, malawi, morocco, mozambique, norway, switzerland, pakistan, panama, pal estine, nigeria, namibia, netherlands, nicaragua, zealand, paraguay, trinidad, started, button |
| (SLD : widowsorwidowers.com) |
|
| zum Seitenanfang ↑ |
| Asexual Personals |
| Welcome - asexualove.net |
| http://www.asexualove.net/ |
| For people seeking friendship or relationships without sex. Browse by category, library, related lin ks and FAQ. |
| asexualove.net -- personals for asexual people seeking friendships and relationships on their own te rms |
| asexual,love,personals,asexual relationship, nonsexual,asexuality,asexualove.net |
| bulletin, distributed, questions, information, website, people, register, asexual, asexualove, modif ied, sections, october, webmanager, suggestions, informed, mailing, german, asexuality, fourth, than ks, finding, subscribe, unsubscribe, relationships, community, personal, bulletin, personals, latest , newsletter, categories, categories, search, conditions, welcome, sitemap, registration, respond, p lease, designed, discussion, further, groups, community, sitemap, helping, additions, latest, naviga te, better, online |
| (SLD : asexualove.net) |
|
| zum Seitenanfang ↑ |
| DateAGolfer.com |
| Free Golf Dating for Golf Singles | DateAGolfer.com |
| http://www.dateagolfer.com/ |
| Personal ads for golfers. |
| Free Golf Dating for Golf Singles, 100% Free Online Dating, Personal Ads, Matchmaking Service for Si ngles at DateAGolfer.com |
| golf singles, golf dating, dateagolfer, dateagolfer.com, free online dating, free personals, dateago lfer, golfmates, my golf date, golf partners, personals, matchmaker, personal ads, love, relationshi ps, golf friends, golf singles, singles golf, golf personals, online dating, single golfers |
| states, united, dateagolfer, florida, female, looking, played, naples, canada, partner, pretty, toro nto, dining, fairly, passion, orlando, someone, marriage, boston, running, tasting, family, basketba ll, friends, kayaking, angeles, shopping, photography, calgary, phoenix, atlanta, chicago, hockey, c itiestoronto, fitness, london, houston, theatre, concerts, hunting, cycling, dallas, fishing, discou nt, worker, energetic, affectionate, honest, things, simple, popular |
| (SLD : dateagolfer.com) |
|
| zum Seitenanfang ↑ |
| LP Date |
| LP Date - Portal and dating site for the little people |
| http://www.lpdate.org/ |
| For people with dwarfism and those wanting to meet them. Articles and directory. Rewuires registrati on. [English and Czech] |
| 'Portal and dating site for people with dwarfism. There is discussion, polls, articles and directory as well. |
| 'date, dating, little people, LP, dwarf, dwarfism |
| people, register, little, dating, password, dwarfism, register, logged, should, statured, informatio n, directory, permanently, dating, discussion, portal, articles, absolutely, blocked, others, molest , contact, people, accessibility, offensive, demanded, truthful, forgot, registred, language, englis h, information, second, normally, change, search, categories, friendship, activity, policy, registra tion, partner, smaller, everybody, useful, informationare, average, course, welcome, proper, manners |
| (SLD : lpdate.org) |
|
| zum Seitenanfang ↑ |
| Spiritual Friend |
| Find Spiritual Friends in your city. Free website connects people who are on a spiritual path. |
| http://www.spiritualfriend.com/ |
| Personal adverts categorized by religious group and location. Art gallery, local groups and Feng Shu i tips. |
| Find spiritual friends and singles in your city or area. Free website connects spiritual people and provides links to recommended spiritual sites. |
| find spiritual friends,spiritual dating website,spiritual singles,spiritual partners,spiritual wife, husband,sufism,sufi,buddhist,buddhism,reiki,srf,hindu |
| gajshost, pagetracker, document, spiritual, 3906605, trackpageview, javascript, script, gettracker, contact, logins, groups, browse, regions, gallery, analytics, spiritual, people, connects, friends, website, 3cscript, unescape, google, weight, 660066, location, protocol |
| (SLD : spiritualfriend.com) |
|
| zum Seitenanfang ↑ |
| Single Booklovers |
| Single Booklovers. Personals. Search personal profiles and meet other singles who love books, reading, arts and culture. |
| http://www.singlebooklovers.com/ |
| For individuals interested in reading, books and culture. Profiles are featured in the members newsl etter and can be purchased. FAQ and membership details. |
| Search personal profiles of single men and women who love books, reading, arts and culture.National organization established 1970 |
| single,booklovers,book lovers,literary singles,book lovers dating,book lovers singles,single readers ,booklovers dating,dating for booklovers,booklovers singles,cultured singles,single men,single women ,intelligent singles,book lover singles,book lovers singles,book lover dating,book lovers dating sit e,single profiles,single men profiles,book lover personals,single women profiles,dating book lovers, book reading singles,literary dating sites |
| single, single, reading, booklovers, single, booklovers, culture, literary, images, background, head er, intelligent, cultured, navigator, helping, document, sizingmethod, website, filter, enabled, alp haimageloader, microsoft, progid, dximagetransform, design, singles, literary, connection, reader, s haresyour, someone, seeking, passion, appname, e5ffc8, anything, secondary, 009905, netscape2, prima ry, appversion, looking, parseint, templates, pleasure, doubled, acquainted, mansfield, katherine, a nother, shares |
| (SLD : singlebooklovers.com) |
|
| zum Seitenanfang ↑ |
| IRC #devotees |
| IRC #devotees, a place for disabled guys to chat with female devotees. Meet a disabled guy. |
| http://ircdevotees.tripod.com/ |
| A place for disabled guys to meet and chat with female devotees. Devotees are special people and the re are many disabled guys who would like to meet them. |
| IRC devotees, a place for disabled guys to meet female devotees. Chat with disabled men. |
| meet female devotees,meet a disabled guy,disabled singles,disability and relationships, disability a nd love,disability singles chat,chat with disabled men,love for men in wheelchairs,love for disabled men,female devotees, female devotee chat,female devoteeism,about female devoteeism |
| height, background, social, images, position, repeat, important, window, search, container, margin, document, button, padding, display, jquery, tripod, category, function, decoration, section, documen telement, relative, adbanner, sprite, devotees, onbutton, normal, hidden, animate, family, onsearch, onshare, disabled, setforcedparam, return, clientheight, clientwidth, center, absolute, replace, co ntain, member, cursor, helvetica, underline, hosted, pointer, overflow, weight, innerwidth |
tripod.com - rank der domain 857 (45 in JP)
|
|
| zum Seitenanfang ↑ |
| Smoke Free Singles |
| Smokefreesingles.com - Dating Personals for Non Smokers |
| http://www.smokefreesingles.com |
| Internet dating personals for singles looking to establish a relationship with other non-smokers. |
| Smoke Free Singles is an online dating service with free personals for singles that don't smoke . Thousands of sincere personal ads currently listed in our date finder search. Lets find you a life partner. |
| non smoking dating, non smoking singles, non smoking partner, smoke free dating, smoke free partners , smoke free singles, NSM, NSF, non smoking male, non smoking female, single non smokers. |
| element, smoking, eventobj, toggle, singles, dating, function, previous, smokefreesingles, search, d ating, select, female, username, seeking, gender, return, profile, location, checkel, document, roma nce, elements, effects, personals, backgroundcolor, intended, singles, submit, highlightcolor, highl ight, looking, relationship, greater, checked, seeking, internet, wanting, profile, california, webs ite, members, depends, smokefreesingles, import, password, subdomains, parentnode, function, logins, bookmarkurl |
| (SLD : smokefreesingles.com) |
|
| zum Seitenanfang ↑ |
| Pagan Partners |
| Pagan Partners - UK dating for online pagans. |
| http://www.paganpartners.co.uk |
| The UKs contacts dating agency for all people of a pagan faith. Free subscription. Over 18s only. |
| |
| |
| height, dating, partners, openscript, people, straight, females, search, members, pagans, profile, k indly, provided, picture, scrollbars, resizable, menubar, weddingclick, status, window, momentpp2136 pp1741pp2097pp2057, function, administrator, paganpartners, magical, bridal, rivendell, problem, pas sword, contact, photos, couple, username, forgotten, becoming, please, leading, services, welcome, h elping, partner, collect, advert, online, lesbian, questions, upload, favorites, messages, messaging , photos |
| (SLD : paganpartners.co.uk) |
|
| zum Seitenanfang ↑ |
|
