| Village Kitchen |
| Home |
| http://www.villagekitchen.com/ |
| Professional cookware, glassware, kitchenware, and cutlery. Brands include Durand, Arcoroc, and Trid ent. |
| Home Page |
| Home Page |
| product, recalculate, document, window, add2cart, sorrento, ballon, connoisseur, rectangular, produc ts, thiswebsite, decanter, pitcher, current, flowers, sterling, covered, privacy, ramekin, specials, village, canterbury, kitchen, souffle, plenitude, category, account, shopping, copyright, sitemap, tarmac, create, shaped, redding, executeoneverypage, bottom, pagename, msgloading, getpublicscartser vice, getpublicwebsiteservice, searchfit, software, customer, service, dinnerware, address, password , product, pitchers, information, reviews |
villagekitchen.com - rank der domain 985844 (410886 in US)
|
|
| zum Seitenanfang ↑ |
| Cooking.com |
| Cooking.com - International Shipping |
| http://www.cooking.com |
| Find kitchen appliances, cookware, cutlery, cook's tools, bakeware and tableware. Also offers a libr ary of recipes and cook's tips. |
| Quality kitchenware and cooking recipes for cooks. Find top rated Cookware, Bakeware, Gift Idea, Cut lery and more at Cooking.com |
| kitchenware, bakeware, cookware, Calphalon, All-Clad, Cuisinart, Kitchen-Aid, Wusthof |
| search, document, typeof, undefined, getelementbyid, product, cachebuster, contact, guarantee, satis faction, stores, 10000000000, collection, recipe, popular, searches, advanced, random, brands, guide s, recipes, celebrity, community, classname, topbar, values, cooking, international, shipping, newsl etters, buying, account, ffffff, textdecoration |
cooking.com - rank der domain 12036 (4607 in US)
|
|
| zum Seitenanfang ↑ |
| Pacific Merchants Trading Co. |
| Placemats, Restaurant Supply, Wooden Salad Bowls, Serving Trays, Small wares, Wholesale Placemats, Room Service Trays, Mason Cash |
| http://www.pacificmerchants.com/ |
| Hardwood bowls, spoons, cooking tools, corkscrews and wine accessories from the United States and ar ound the world. |
| We sell quality placemats, Wooden salad bowls, serving trays, small wares, wholesale placemats, rest aurant supply, Mason Cash, room service trays, place mats and serving trays at great prices! If you looking for info about acacia wood, acaciaware, acacia ware then click here. Pets bowl, Dog Food Bow l, Pet Water Bowl, Dog Water Bowls, Pet Mats, Cat Water Bowl |
| Placemats, wholesale place mats, wooden salad bowls, Mason Cash, serving trays, small wares, polyvin yl placemats, restaurant supply, room service trays, acacia wood, acaciaware, acacia ware, wooden bo wls, pets bowl, pet water bowl, Pet Mats, dog food bowl, dog water bowls, cat water bowl |
| indexof, return, cutting, dining, pacific, quality, emailid, placemats, merchants, summer, restauran t, cutting, wholesale, address, rectangle, flexible, getelementbyid, document, supply, serving, prod ucts, serving, promotions, substring, service, retail, wholesale, wooden, service, diverr, summer, a ccessories, placemats, acacia, mortar, policy, acaciaware, endless, request, catalog, newsletter, in valid, diameter, macfab, simply, function, echeck, malibu, tailgate, symbol, saleen |
| (SLD : pacificmerchants.com) |
|
| zum Seitenanfang ↑ |
| Shopping/Home_and_Garden/Kitchen_and_Dining |
|
|
| Shopping/Home_and_Garden/Kitchen_and_Dining |
| zum Seitenanfang ↑ |
| Taylor and Ng |
| Taylor and Ng |
| http://www.taylorandng.com/ |
| From woks and mugs to saucepans and pot racks, well designed and versatile products. Known for their Track Rack System for storing pots and pans. |
| woks and mugs to saucepans and pot racks, well designed and versatile products. Known for their Trac k Rack System for storing pots and pans |
| woks and mugs to saucepans and pot racks, Track Rack System for storing pots and pans |
| animates, natural, nonstick, bamboo, search, nitetime, mounted, accessories, taylor, javascript, day time, flying, espresso, sticks, special, cooking, account, checkout, wishlist, anthracite, welcome, advanced, service, contact, webmaster, gaohan, reserved, rights, customer, fortune, sashimi, product , decoratetable, primitives, shopping, footer, content, display, storage, kitchen, natural, ceiling, enabled, disabled, browser, website, functionality, utilize, nonstick, translator, classy |
| (SLD : taylorandng.com) |
|
| zum Seitenanfang ↑ |
| Kitchen Collection |
| The Kitchen Collection - As Seen On TV Bakeware Cookware Cutlery & Tools Decorative Gadgets & More Small Appliances |
| http://www.kitchencollection.com |
| Outlet for top brands of kitchen gadgets, tools and small appliances. |
| Kitchen Collection As Seen On TV Bakeware Cookeware Cutlery And Tools BBQ Gadgets And More Small App liances Clearance Closeouts Store Locator Gift Ideas Cards Business To 2 Business |
| Kitchen Collection, stores, store, Cuisinart, Old Dutch, Corelle Hamilton Beach, KitchenAid Aid, Pro ctor Silex, Blender, Toaster, Mixer, Coffee Maker, Oven, Silicone, Discount, Sale |
| kitchen, browse, family, verdana, cookware, bakeware, appliances, gadgets, decorative, cutlery, coll ection, border, clearance, policy, business, shopping, shipping, background, ffff9f, decoration, bod ylinks, comments, return, opportunities, gadget, bookmark, everyday, newsletter, subscribe, distance , select, stores, special, offers, closest, locator, seenon, account, category, create, buttons, bol dstrings, buttons, textboxes, always, purchases, shipping, thirstystone, corelle, wilton, brands |
kitchencollection.com - rank der domain 268215 (105446 in US)
|
|
| zum Seitenanfang ↑ |
| The Posh Peddler |
| Pure certified organic Moroccan argan Oil |
| http://www.theposhpeddler.com |
| World's finest bakeware for even heat distribution and great looking and tasting baked products. Var iety of hand-forged cutlery, made in America. |
| Our oil is produced in the Agadir region of Morocco using the finest filtering process. |
| organic argan Oil, certified, cosmetic grade, moroccan gold, agadir, moroccan oil, Fibrament Pizza S tones, Decorative Flags |
| details, stones, decorative, spring, fibrament, certified, breads, organic, summer, regular, beauty, rectangular, excellent, bottle, morocco, agadir, category, decorative, related, produced, returns, peddler, position, special, shopping, family, border, contact, weight, services, shipping, payment, products, margin, autumn, wholesale, winter, moroccan, easter, collection, sports, secure, website, offers, electric, customer, policy, cleaning, recognized, widely, respected |
| (SLD : theposhpeddler.com) |
|
| zum Seitenanfang ↑ |
| Katherine's Kitchen Emporium |
| Kitchen Emporium sees to all your cooking product needs with a wide variety of gourmet kitchen products |
| http://www.kitchenemporium.com/ |
| Source for kitchen items including appliances, potracks, cookware, bakeware, and utensils. |
| A Kitchen Emporium is your online source for purchasing cooking and baking items. Here you will find bakeware, cookware, cutlery, pot racks, utensils and butcher block tables |
| kitchen, online, store, retail, cutting board, pan, gift, bar, heart, valentines, waffle, egg, panca ke, ring, mold, Kitchen Emporium, cooking, baking items, bakeware, cookware, cutlery, pot racks, ute nsils,
cuisinart, old dutch, norpro, prodyne, catskill, farberware, salton, toastmaster, cucina pro , villaware, allclad, chefs choice, chefs specialties, broilking, russell hobbs, world cuisine,
pol der, bonjour, chicago metallic, eurocuisine, joyce chen, max burton, athena, waring, swiss diamond, nordicware, edgecraft, butcher block tables, copper, frying pans, seasonal, holiday,
creme brulee, pizza, taco, mexican, texmex, tex mex, kitchen cart, kitchen carts, kitchen island, bbq, summer fair , blenders, blender, and many more |
| contact, policies, raclette, cheese, melter, product, featured, directory, kitchen, cooking, kitchen , emporium, product, gourmet, variety, products |
kitchenemporium.com - rank der domain 992280 (406775 in US)
|
|
| zum Seitenanfang ↑ |
| Chefs Catalog |
| CHEFS: The Best Kitchen Starts Here |
| http://www.chefscatalog.com/ |
| Learn about a variety of professional and home kitchen appliances and cookware. |
| Shop CHEFS for the best cookware, cutlery, kitchen electrics and tools for the cooking enthusiast an d home chef since 1979. |
| CHEFS, CHEFS Catalog, CHEFS Catalogue, Kitchen, cookware, bakeware, kitchen electrics, small applian ces, cutlery, kitchen knives, kitchen tools, sale, gift ideas, outdoor cooking, All-Clad, Cuisinart, Calphalon, Le Creuset, Magimix, Scanpan, Henckels, Wusthof, KitchenAid, Chef's Choice, Delonghi, W aring, Shun, Chicago Metallic |
| lpmtagconfig, kitchen, international, function, triggerobj, shipping, player, pagetracker, please, t ypeof, omnitureattributesxmldoc, currency, lpmtagsrc, lpprotocol, international, indexof, shipping, lpnumber, omnitureattributeselement, united, customers, choose, republic, select, products, selectin g, canada, lpserver, country, currency, linkobj, chefscatalogcom, aw4df4001, eventname, suriname, sw eden, thailand, taiwan, switzerland, slovakia, slovenia, africa, omnitureportalevents, trinidad, vie tnam, ukraine, turkey, tobago, singapore, kingdom, emirates |
chefscatalog.com - rank der domain 40794 (15591 in US)
|
|
| zum Seitenanfang ↑ |
| Shopping/Home_and_Garden/Kitchen_and_Dining |
|
|
| Shopping/Home_and_Garden/Kitchen_and_Dining |
| zum Seitenanfang ↑ |
| Salamander Select |
| Cookware, Kitchen Accessories & Equipment, Salamander Cookshop UK |
| http://www.salamandercookshop.com/ |
| Features cookware, bakeware, utensils and kitchenware from Henckels, La Forme, Kaiser, Wusthof, Merm aid and Fissler Bounds. |
| High quality cookware, bakeware, knives, mills, kitchen equipment and utensils from the UK and aroun d the world - a comprehensive range with helpful service. |
| Sharpeners, Scissors, Saws and Shears Cookware Kitchen Knives and Carving Forks Bakeware Mills Kitch en Utensils & Gadgets Storage, Rails and Racks Wine Accessories, Carafes & Barware Textiles Coffee M akers, Grinders & Drinking Chocolate Kitchen Trolleys and Butchers Blocks Kettles Aga Sundries Gift Vouchers Electrical Items Picnics and Barbecues Tableware & Glassware Weighing, Measuring & Timing J uly Cooking Gift Ideas Bowls & Serving Dishes & Trays Spare Parts & Cleaning Materials As Featured I n......... Tea Making Refuse Bins What's New Delivery Surcharge Cookware, Bakeware, Knives, Kitchen Textiles |
| berndes, bialetti, browse, accessories, barwarepicnics, carafes, blockswine, barbecueskettlesaga, co okingspare, vouchersjuly, sundriesgift, butchers, trolleys, makers, makingcoffee, binstextilestea, g rinders, chocolateelectrical, drinking, itemskitchen, cleaning, benriner, birkmann, brabantia, cryst al, atlantis, surchargespecials, materialsdelivery, racksrefuse, alligator, induction, traysweighing , contact, 0total, search, kitchen, cookware, equipment, salamander, advanced, cookshop, category, g adgetsbowls, utensils, shearsmillskitchen, serving, dishes, glasswarestorage, timingtableware, measu ring, scissors |
salamandercookshop.com - rank der domain 928573 (29971 in GB)
|
|
| zum Seitenanfang ↑ |
| Kitchen Kitchen |
| Kitchen Kitchen - For The Chef In You! |
| http://www.kitchenkitchen.com |
| Supplies gourmet cookware, cutlery, bakeware, gadgets, and other kitchen accessories. |
| Kitchen Kitchen provides high quality goumet kitchen products for the chef or chef to be. We have ev ery type of kitchen gadget for your cooking needs. |
| kitchen gadgets, bakeware, barware, bamboo cutting boards, bamboo products, coffee and tea, cookware , cutlery, gadgets, guess the gadget, hot pads, oven mitts, pepper and salt mills, wine accessories, BBQ |
| kitchen, normal, border, margin, family, kitchen, classes, gadget, products, weight, gadgets, gourme t, cookware, cucina, cooking, gadget, quality, document, decoration, b87333, underline, bottom, page tracker, calibri, gajshost, center, favorite, script, making, avocado, javascript, choose, selected, alberto, gorgone, conducted, trackpageview, 4545753, limited, gettracker, recent, indian, location, protocol, corner, winner, contest, coffee, located, google, analytics |
| (SLD : kitchenkitchen.com) |
|
| zum Seitenanfang ↑ |
| Past and Present |
| Past & Present Discontinued China, Crystal, Sterling, Stainless, Silverplate,
Pewter and Dirilyte Tableware |
| http://www.pastpresent.net/ |
| Features a wide array of discontinued china, crystal, sterling, stainless, silverplate, pewter and d irilyte tableware. Also offers to repair, appraise, identify, or purchase items. |
| |
| |
| discontinued, haviland, sterling, stainless, silverplate, dirilyte, staffordshire, tableware, crysta l, pewter, fraser, stieff, anchor, rogers, albert, richard, oxford, meakin, taylor, whiting, dirilyt e, vernon, warwick, present, jackson, limoges, mottahedeh, celebrity, waechtersbach, edelstein, vict oria, diamond, sheffield, rogaska, ginori, meissen, embassy, kaysons, lambert, faberge, bristol, can onsburg, louisville, calhoun, pottery, brebtwood, newcor, orrefors, forest, eschenbach, arzberg |
pastpresent.net - rank der domain 966677 (403701 in US)
|
|
| zum Seitenanfang ↑ |
| Gracious Style |
| Fine Table Linens, Tablecloths, Luxury Bedding, Duvet Covers, Sheets, Dinnerware |
| http://www.graciousstyle.com |
| Includes table linen, bedding, and bath linens. Also offers dinner and flatware. |
| Table linen, tablecloth, bedding, duvet cover, dinnerware, bath towel, flatware. |
| table linens linen tablecloths napkins placemats runner luxury bedding bath towel dinnerware monogra m |
| length, category, graciousstyle, document, rothrefs, rotimages, linens, function, dinnerware, websto re, control, registry, rotsize, bedding, images, pillows, towels, registry, rannum, leblanc, bedding , header, doonload, linens, getelementbyid, throws, napkins, location, monogrammed, rotateimage, pag etracker, liners, dinnerware, decorative, tablecloths, covers, gajshost, dorotatinglink, sheets, con tact, catalog, addthis, questions, follow, rights, analytics, google, 3cscript, protocol, unescape, javascript |
graciousstyle.com - rank der domain 685055 (269345 in US)
|
|
| zum Seitenanfang ↑ |
| Chef Revival |
| |
| http://www.chefrevival.com/ |
| Offers an array of professional apparel, footwear, cutlery, tools and skin care products for chefs. |
| |
| |
| |
| (SLD : chefrevival.com) |
|
| zum Seitenanfang ↑ |
| Dvorsons |
| Dvorson's Food Service Equipment and Appliances - Home of the Best Kitchen Equipment in the World. |
| http://www.dvorsons.com/ |
| Retailer of Dynasty stoves, cooktops, and grills as well as cutlery and cookware. |
| The best place for Wolf Range Stoves and the best Kitchen and Restaurant Equipment and Appliances |
| wolf stove, wolf ranges, bunn, bunn-o-matic, resturant equipment kitchen supplies, blenders, butcher block work tables, coffee makers, ranges, cooktops, stoves, wine openers, pot racks, dishwashers, d ispensers, processors, dough mixers, undercounter reach-in upright refrigerators, chest freezers, gr ills, griddles, La Pavoni, Pasquini, DHC, Sitram, Cookware, Pans, Turbo Air, Frigedaire, Asko, Jet-t ech, Sunkist, Vent A Hood, Johnboos, Dvorson's Food Service Equip. We Carry the best Equip for Comme rcial and Residential Kitchen. Wolf, Jade, Jimex, MagiCater, Cadco, Dynasty, Imperial, Traulsen, Pit co Frialator, Tibos, Krampouz Crepe Maker, WearEver, Regal, Wusthof, Iwatani, All Clad, Kitchenaid, acutlery, knives, toasters, hoods, juicers, espresso machines, shelving, grinders, outdoor BBQ, Boos , Cuisinart, Vita-Mix, Vitamix, Dualit, Dynasty, pizza warmers, pizza ovens, washer, dryers, popcorn poppers, pretzel, shave ice, snow cone, waffle, sharpeners, steam, beer coolers, display cases, bun trays, meat slicers, me |
| refrigeration, ranges, equipment, coffee, machines, commercial, griddle, cookware, stainless, portab le, stoves, display, tables, grills, residential, microwave, convection, conveyor, american, outdoor , espresso, cabinets, toasters, summit, slicers, matfer, mixers, heaters, induction, waring, broiler s, kitchen, vollrath, replacement, frigidaire, juicers, dispenser, makers, beverage, panini, cooktop s, sitram, lincoln, dishwashers, products, advance, brewers, griddles, knives, machine, dishwasher |
dvorsons.com - rank der domain 946439 (352939 in US)
|
|
| zum Seitenanfang ↑ |
| Kitchenworks, Inc. |
| Kitchenworks | Your One Stop Kitchen Supply Store. |
| http://www.kitchenworksinc.com |
| Cookware, knives, gadgets, pot racks, glassware and bakeware. Ships in USA. |
| |
| |
| kitchen, gadget, cuisinart, gadgets, cookie, boards, kitchen, cutters, gadgets, cookware, kitchenwor ks, accessories, cutting, cooking, glasses, silicone, knives, baking, series, brushes, holiday, plat es, stainless, dishes, berndes, slicer, pastry, henckels, strainers, cupcake, spoons, serving, veget able, orange, silver, wusthof, cupcakes, servers, decorating, holders, supply, scoops, butter, glass ware, measuring, fashioned, spatulas, coffee, designed, makers, containers |
kitchenworksinc.com - rank der domain 917747 (375322 in US)
|
|
| zum Seitenanfang ↑ |
| The Gourmet Kitchen |
| Gourmet Cookware and Bakeware by The Gourmet Kitchen |
| http://gourmet.org/ |
| Carrying name brands such as Fagor, Krups, Romertopf, and Thermos Nissan. |
| Gourmet Cookware, Bakeware, Kitchenware. Top quality gourmet products, kitchen utensils, cutlery, ga dgets, cookware, and kitchen tools |
| Cookware, Bakeware, Kitchenware,coffee makers, thermometers, gourmet products, gourmet kitchen produ cts, glassware, all-clad, calphalon, krups, thermos, romertopf, viking, capresso, back to basics, cu tlery, kitchen utensils, |
| gourmet, cookware, cookware, bakeware, kitchen, appliances, service, policy, customer, products, cle arance, premium, bakeware, through, numerous, browse, utensils, brands, online, prices, offered, 906 947, containers, cooking, including, thermos, bakers, glassware, kitchen, return, contact, resources , privacy, featured, bottles, vacuum, stanley, professional, gourmet, outdoors, serveware, keeping, flatware, search, appliances, urchintracker, favoritegourmet, indulge, tableware, storage, organizat ion |
gourmet.org - rank der domain 949430 (407913 in US)
|
|
| zum Seitenanfang ↑ |
| TableTalk |
| Table Talk – Tucson Furniture & Housewares |
| http://tabletalk.com |
| Nearly everything for your kitchen from cutlery to cookbooks. |
| |
| |
| tucson, searchtextdefault, searchbox, searchboxmain, searchfocus, document, searchblur, function, or acle, gajshost, tanque, broadway, furniture, active, housewares, pagetracker, shoppers, newsletter, functional, possible, private, customer, address, service, protocol, javascript, script, 2678271, ge ttracker, analytics, google, location, reserved, rights, trackpageview, comfortable, unescape, 3cscr ipt, gadgetsmitts, potholders, foodskitchen, teacookwarecutlerygourmet, officeliving, roomseatingkit chenbarwarecoffee, aprons, glovessoaps, specials, stores, napkinsserveware, lotions, bathtabletopdin nerwaredrinkwareflatwareplacemats |
tabletalk.com - rank der domain 980335 (364104 in US)
|
|
| zum Seitenanfang ↑ |
| Home Processor |
| The Home Processor |
| http://www.home-processor.com/ |
| Offers butcher supplies such as grinders, cubers, slicers, knives, packaging supplies, and seasoning s. |
| The Home Processor |
| |
| supplies, processor, equipment, processing, grinders, search, without, prices, service, subject, not ice, hunting, change, fishing, commercial, scooters, trailers, information, reproduction, rights, re served, medium, prohibited, permission, express, written, directive, related, processing, occurred, fisherman, gainesville, copyright, roasting, cubers, hamburger, blades, sausage, seasoning, cutlery, slicers, quality, products, butcher, competitive, prompt, reliable, delivery, wrapping, baking, coo king |
| (SLD : home-processor.com) |
|
| zum Seitenanfang ↑ |
| New England Cheesemaking Supply Company |
| CheeseMaking - Online Store |
| http://www.cheesemaking.com/ |
| Cheesemaking equipment, advice and recipes. |
| You have found the source for all your cheesemaking supplies and recipes. |
| Cheesemaking Supplies, How to Make Cheese, Cheese Ingredients, Rennet |
| cheese, cheesemaking, england, supply, workshops, mozzarella, information, classified, equipment, be ginners, ingredients, kingsolver, barbara, discounts, select, special, merchandise, cheese, deerfiel d, whately, cheesemaking, friday, monday, family, making, joining, vegetable, miracle, thanks, stori es, photos, copyright, coming, animal, future, videos, facebook, events, organizations, section, rip ening, molding, rennet, cheesemakers, travels, search, account, cheesemaking, online, search, recipe s |
cheesemaking.com - rank der domain 193485 (76220 in US)
|
|
| zum Seitenanfang ↑ |
| Peppercorn |
| Home Page | The Peppercorn |
| http://www.peppercorn.com/ |
| Retail and online sales of cookware, barware and other kitchen related items, from the store in Boul der Colorado. |
| Peppercorn |
| Peppercorn |
| peppercorn, rating, approval, permission, boulder, function, gajshost, document, pagetracker, reload , recycled, street, colorado, throughout, goozmo, systems, powered, vignettes, printed, unescape, sc ript, javascript, gettracker, trackpageview, 10017962, protocol, inviting, 3cscript, analytics, goog le, location, designers, content, goodirector, goojax, window, onload, historic, downtown, located, welcome, events, bridal, upcoming, registry, search, contact, pedestrian, diverse, uniquely, arrange d |
| (SLD : peppercorn.com) |
|
| zum Seitenanfang ↑ |
| Golda's Kitchen |
| Bakeware, Cookware, and Cake Decorating Supplies |
| http://www.goldaskitchen.com/ |
| Canadian retailer presents baking, cooking and measuring equipment and a wide assortment of kitchen tools, knives and appliances. |
| |
| |
| decorating, supplies, bakeware, cookware |
goldaskitchen.com - rank der domain 659413 (11616 in CA)
|
|
| zum Seitenanfang ↑ |
| iKitchen2000.com |
| iKitchen2000.com - Featuring Henckels Knives, Wusthof Cutlery, Shun Knives, Kyocera Knives, Global Knives |
| http://www.ikitchen2000.com |
| Offers professional knives and cutlery, cookware, pressure cookers, tableware, and juicers including the Wusthof-Trident, Sabatier, Messermeister, WMF, and Kuhn Rikon brands. |
| A professional online kitchen store featuring only the famous finest name brands like Wusthof Triden t, Henckels, Sabatier, Messermeister, WMF, Kuhn Rikon |
| wusthof trident, J.A. Henckels, messsermeister, sabatier, aeternum, miracle,wusthof, kuhn rikon, wus thof knives,wusthof-trident,wusthof cutlery,sabatier, WMF, knives, cutlery, cookware, flatware, juic ers, small appliance, solingen,pressure cooker |
| decoration, qualified, purchase, verdana, knives, helvetica, weight, products, normal, special, henc kels, ikitchen2000, wusthof, kyocera, underline, messermeister, border, cutlery, ffffff, cutlery, se cure, location, 000000, function, fortessa, ikitchen2000, finest, matfer, quality, france, weight, g lobal, shears, kitchen, kitchen, trident, pillivuyt, sabatier, miracle, kitchenaid, legnoart, masahi ro, kershaw, cuisine, gerlach, innova, kasumi, epicurean, materials, sharpening, products |
| (SLD : ikitchen2000.com) |
|
| zum Seitenanfang ↑ |
| Kitchen Kapers |
| Kitchen Kapers - Fine Cookware, Bakeware, Cutlery, Coffee and Espresso Machines, and More Since 1975 |
| http://www.kitchenkapers.com |
| Features gourmet cooking appliances, ranging from cutlery, cookware, and blenders to smoothie machin es, coffee makers and kitchen accessories. |
| Specializing in fine cookware, bakeware, cutlery, coffee and espresso machines, and much more since 1975. Large selection of leading brands, including Jura-Capresso, Delonghi, All Clad, Calphalon, Le Creuset, Wusthof, and much more. |
| cookware, bakeware, cutlery, knives, coffee, espresso machines, Jura, Capresso, automatic coffee cen ters |
| chance, analytics, espresso, ystore, coffee, kitchen, ywatracker, pepper, beverage, cocktail, window , domain, picnic, sanitizing, cleaning, bottle, refurbished, pitchers, cooking, machines, generated, create, baskets, candle, upfront, grilling, holders, capresso, peugeot, creuset, events, rothschild , accessoriesbarbecue, cookbooksbbq, accessoriescake, napkins, domains, playful, beacon, docname, pr oject, bakeware, kapers, backyard, knives, pimpernel, function, stovetop, placemats, docgroup, dinne rware |
kitchenkapers.com - rank der domain 624868 (242933 in US)
|
|
| zum Seitenanfang ↑ |
| Shipshewana Hardware, Inc. |
| Yoder's Shipshewana Hardware, Inc. |
| http://www.yodershardware.com/ |
| Offers a range of pottery, cookware, and oil lamps as well as lawn and garden items. |
| |
| |
| shipshewana, hardware, august, 2010blue, saturday, 2010more, contact, selection, merchandise, indian a, antique, marketsaturday, unique, wednesday, location, october, online, designs, auctionfriday, tu esday, account, available, wishlist, market, kitchen, auction, information, windowurl, function, win downame, windowfeatures, shopping, 2010trading, concertfriday, newsletter, center, redeemer, markets hipshewana, 5pmmay, tourmay, informationthe, gardens, auctionquilt, offering, visitors, wheelchair, rentals, reservations, rentalsin, 30pmwednesday, wheelchair |
| (SLD : yodershardware.com) |
|
| zum Seitenanfang ↑ |
| J and L Partridge Company |
| |
| http://www.partridgecompany.com/ |
| Offers a range of dinnerware, ironstone, and linens. |
| |
| |
| |
| (SLD : partridgecompany.com) |
|
| zum Seitenanfang ↑ |
| Home Evolution |
| Home Evolution | Contemporary Furniture, Housewares, and Gift Registry in Calgary, Alberta |
| http://home-evolution.com |
| A lifestyles store filled with products for the dining rooms, kitchen, and bath. |
| Home Evolution is Calgary's premiere lifestyle store designed specifically with the Calgary consumer in mind. We carry unique items from vases and picture frames, to fine china and dining room suites all reflecting a contemporary and modern lifestyle and interior design. |
| furniture, housewares, decor, registry, design, designer, interior, dining, living room, bed, bath, gift, wedding |
| thumbwidth, animto, runwaythumbs, evolution, function, direction, runway, change, duration, position , bottle, document, gajshost, evolution, pattern, vertical, length, outerwidth, dontanimate, registr y, furniture, calgary, thumbnails, pagetracker, location, 963182, location, protocol, accents, acces sories, entertaining, living, dining, corporate, trackpageview, twitter, communityfollow, contact, p rivacy, policy, careers, products, colours, notice, without, prices, javascript, exactly, select, sh owcases, runway |
| (SLD : home-evolution.com) |
|
| zum Seitenanfang ↑ |
| SFY Distributing |
| Stainless steel cookware, cooking utensils, cooking gadgets, and household
items from SFY Distributing! |
| http://www.s-f-y.com/ |
| Cookware, utensils and housewares. |
| SFY offers professional quality stainless steel cookware, bakeware, and kitchen utensils at affordab le prices. Premium quality stainless steel cookware that you'll be thrilled to own and use and will still be in excellent shape for years to come - guaranteed. |
| stainless steel cookware, silverware, bakeware, cookware, induction cookware,waterless cookware, pro fessional quality stainless steel cookware, professional cookware, professional quality cookware, wa terless cooking, cooking, healthy cooking, silver service, food preparation aids, barbeque equipment , household goods |
| document, cooking, cookie, cookware, function, stainless, silver, status, length, exitpopup, screen, setcookie, endstr, return, allows, offset, silverware, quality, windowoptions, bakeware, service, s erving, finest, loggedin, clocks, control, availheight, utensils, arguments, kitchen, availwidth, di stributing, spawnjimcopopup, scaletype, options, newwindow, knives, indexof, expiry, getcookieval, s ubstring, getcookie, gadgets, addition, carving, includes, plated, preparation, equipment, simply, f inish |
| (SLD : s-f-y.com) |
|
| zum Seitenanfang ↑ |
| Annex Cookery |
| Welcome to The Annex Cookery Web Store |
| http://www.annexcookery.com |
| Features gourmet specialty kitchen tools and cookware, including appliances, cutlery, and tablewares . |
| |
| |
| cookery, welcome |
| (SLD : annexcookery.com) |
|
| zum Seitenanfang ↑ |
| Questo Design |
| Questo Design European modern Design - Questo Design |
| http://www.questodesign.com/ |
| Offers a wide range of household products from vendors like Alessi, Zack, Maggis, Kartell, Mondaine, and Ritzenhoff. Based in The Netherlands. |
| |
| |
| |
questodesign.com - rank der domain 988679 (16838 in NL)
|
|
| zum Seitenanfang ↑ |
| Campbell's Gourmet Cottage |
| Campbell's Gourmet Cottage |
| http://www.gourmetcottage.com/ |
| Offers brand name cookware, bakeware, cutlery, kitchen gadgets, utensils and kitchenware. |
| |
| |
| cottage, gourmet, campbell |
| (SLD : gourmetcottage.com) |
|
| zum Seitenanfang ↑ |
| Sunny Web Shops, Inc. |
| Sunny Kitchen - Kitchen Furniture - Kitchen Islands, Kitchen Carts, Cupboards |
| http://sunnykitchen.com/ |
| Offers kitchen islands and carts, as well as cupboards, dining tables, stools and chairs. |
| Sunny Kitchen sells quality kitchen furniture online: kitchen islands, carts, cupboards, and more - free US shipping, discount prices, quick delivery. |
| kitchen islands, kitchen furniture, kitchen carts, cupboards, butcher block, Catskill Craftsmen, Hom e Styles, kitchen island, kitchen cart, cutting boards |
| kitchen, kitchen, island, furniture, shipping, policy, delivery, butcher, discount, cupboards, price s, islands, islands, furniture, returns, breakfast, design, secure, assemble, include, online, price s, canada, details, contact, shopping, helpful, shopping, serviceprivacy, product, feedback, custome r, contact, copyright, service, guaranteed, boards, cutting, quality, hardwood, catskill, craftsmen, cupboards, tables, cabinets, microwave, online, dependable, offering, urchintracker, designed |
| (SLD : sunnykitchen.com) |
|
| zum Seitenanfang ↑ |
| Cooks' World |
| Cooks' World - cookware, cutlery, kitchen appliances, gadgets, food processors, pressure cookers |
| http://www.cooksworld.com/ |
| Specializes in cookware, kitchen appliances and gadgets. Brands include All Clad, Calphalon, Cuisina rt, Kitchen Aid, and Le Creuset. |
| Gourmet kitchen store specializing in cookware, cutlery, bakeware, kitchen appliances, gadgets, food processors, dutch oven and pressure cookers. Brands include All Clad, Calphalon, Cuisinart, Kitchen Aid and Le Creuset. |
| cookware, cutlery, kitchen appliances, kitchen gadgets, food processors, dutch oven, pressure cooker s, all clad, calphalon cookware, cuisinart cookware, kitchen aid appliances, le creuset cookware |
| kitchen, cuisinart, trident, calphalon, creuset, kitchen, wusthof, processors, gadgets, appliances, cookware, cutlery, cookers, pressure, brands, specials, zyliss, zojirushi, bounds, villaware, bakewa re, global, henckels, include, entire, rights, reserved, contents, specializing, gourmet, taylor, gi ftware, microplane, cookware, delonghi, appliances, choice, harold, import, gourmac, chantal, bormio li, brisker, browne, metallic, chicago, chemex, capresso, henckel, designs, nordicware |
| (SLD : cooksworld.com) |
|
| zum Seitenanfang ↑ |
| Gourmac Inc |
| Gourmac / Hutzler Mfg, - housewares, bakeware, savers, gadgets, tabletop, kitchen gourmet |
| http://www.gourmac.com/ |
| Offers cooking utensils, bakeware, cookie cutters, melamine dinnerware, gadgets and recipes. |
| |
| Gourmac, Hutzler, cookie press, funnels, cookie cutters, melamine, utensils, melamine bowls, housewa res, kitchen, kitchen gadgets, spoons, tableware, melamine plates, dishes, platters, cookie stamps, bakeware, wooden utensils, stainless steel utensils |
| housewares, gourmac, experience, bringing, gadgets, tabletop, hutzler, gourmet, kitchenwares, online , quality, baking, popular, recipes, selection, browse, please, designed, forget, simplify, kitchens ervingstoragebakewarecookie, cuttersfor, basicsgadgetsbowlsutensilsfun, kitchen, kidsfunnelsoverstoc ksholiday, shoprecipeswholesalehome, cartcopyright, gourmac, requests, creativity, through, secure, server, please, assistance, customer, 49buffet, marinating, 99tendermade, markers, thrilled, welcome , shopping, 99thank, kitchen, savers, bakeware, homestore, infoemail, productsherb, cartsearchfeatur ed |
| (SLD : gourmac.com) |
|
| zum Seitenanfang ↑ |
| International Housewares |
| International Housewares.com - Corelle, Corningware, Pyrex and other top quality housewares shipped to North America and Europe! |
| http://www.internationalhousewares.com/ |
| Shop for a wide range of housewares including small appliances, Corningware, non-stick cookware, sta inless steel kitchenware, and crystal glassware. |
| International Housewares provides brand name home products at discount prices. Our site makes it sim ple for you to click and shop for Corelle/Corningware, stainless steel cookware, and much more. Take advantage of our FREE gift-giving service, and shipping across North America and Europe. |
| housewares, corningware, corelle, accessories, open stock, Callaway, Country Cottage, Rosemarie, Abu ndance, Mikasa, Vereco, dinnerware, kitchenware, home, drinkware, flatware, cookware, plates, bowls, casserole dishes, fry pans, sauce pans, stock pots, gifts, discount prices, Canadian pricing, ship across Canada, United States, Europe |
| housewares, shipped, europe, america, quality, housewares, international, corelle, corningware |
| (SLD : internationalhousewares.com) |
|
| zum Seitenanfang ↑ |
| Scotts of Stow |
| Welcome - Scotts of Stow! |
| http://www.scottsofstow.co.uk/ |
| Suppliers of traditional products for the home, kitchen, and garden. |
| |
| Scotts of Stow, , Home, Kitchen, Dining, Bedroom, Bathroom, Garden & Outdoors, Practical Sol utions, Travel, Sale, |
| function, images, wcsstore, contentspots, consumerdirectstorefrontassetstore, background, kitchen, p adding, dining, parent, 334911, tagcloud, height, mainfield, garden, margin, bathroom, newarrow, sto rage, accessories, repeat, weight, pdlargerimage, fieldprefix, bedroom, 210710, footerlist, helptext , textiles, decoration, fadeimages, promocode1, furniture, servlet, quickshop, lastindexof, substrin g, document, stores, product, return, leftnav, length, children, family, webapp, lighting, appliance s, mouseover, helvetica, oldcaseval |
scottsofstow.co.uk - rank der domain 543884 (17225 in GB)
|
|
| zum Seitenanfang ↑ |
| Sur La Table |
| Cookware, Cutlery, Dinnerware, Bakeware | Sur La Table |
| http://www.surlatable.com/ |
| Offers a wider range of kitchen products including copper cookware, books, linens, bakeware, knives, kitchen electrics, and gadgets. |
| Shop Sur La Table for the finest cookware, dinnerware, cutlery, kitchen electrics, bakeware and more . Our cooking class program is one of the largest in the nation. |
| |
| showmenu, category, images, acatimgs, global, globalnav, length, cookware, kitchenbakeware, electric s, housewares, cutlery, milonic, coffee, menuname, kitchen, serving, menustyle0, overimage, tabletop , summer, 100715, knives, knives, milonic, 100701, function, parent, searchterms, coffee, cookware, electrics, classname, accessories, return, baking, accessories, baking, minkeywordlength, globalnav0 1, button, specialty, bakeware, specialty, onclass, globalnav10, borderwidth, bordercolor, offclass, remain, globalnav02 |
surlatable.com - rank der domain 22497 (8552 in US)
|
|
| zum Seitenanfang ↑ |
| Fante's Kitchen Wares Shoppe |
| Fante's Kitchen Wares Shop - fantes.com |
| http://fantes.com/ |
| Large selection of gourmet cooking utensils, gadgets, appliances, pans, and other kitchen wares. |
| Food preparation utensils, with many unusual items like the chitarra, tajine, duck press, pressure c anner, etc. Extensive interrelated links and detailed buying guides. |
| fante, fantes, kitchen, cook, cooking, culinary, cookware, bakeware, knife, knives, sharpeners, pot racks, pan racks, espresso, cappuccino makers, coffee, tea, philadelphia, chef, recipes, cookbooks, accessories, italian, market |
| fantes, kitchen |
fantes.com - rank der domain 373718 (133701 in US)
|
|
| zum Seitenanfang ↑ |
| Kitchenshop.com |
| Cookware, Custom China, Dinnerware, Housewares and Kitchen Appliances - Kitchenshop.com |
| http://www.kitchenshop.com/ |
| Offers monogrammed and custom china, multi-ply stainless steel cookware, affordable cutlery quality housewares and accessories. |
| |
| |
| kitchenshop, cookware, serving, brands, enrico, products, sengware, products, pagetracker, tovolo, f latware, featured, entertaining, mauviel, stainless, shipping, americas, categories, dinnerware, bea utiful, elegant, document, gajshost, accessories, colors, bakeware, coffee, kitchen, dinnerware, upf ront, exclusive, prograde, tracker, freeze, portable, rocket, available, nutritional, bakeware, serv eware, crafted, island, square, placesettingavailable, leakproof, springform, rootworks, quadro, sig nocast, brewer, thermofresh |
kitchenshop.com - rank der domain 972034 (413966 in US)
|
|
| zum Seitenanfang ↑ |
| The Cook Shop, Inc. |
| The Cook Shop Brewster Cape Cod |
| http://www.cookshopcapecod.com/ |
| Retailer that offers a wide range of kitchen products including appliances, dinnerware, tabletop ite ms, hard to find tools, Cape Cod and New England products. |
| Gourmet and Tabletop Shop at Lemon Tree Village in Brewster, Cape Cod. Family run since 1978. Wher e to buy all your kitchen and dining needs on Cape Cod. |
| cookshop, cook shop, cookware, gourmet, gourmet food, tabletop, tableware, kitchen, cookinh, kitchen ware, capecod, cape cod, flatware, dining, utensils, gadgets, soda stream, cookbooks, brewster, cook book, coffee, tea, condiments, olive oil, balsamic, aprons, linens, tablelinens, asian food, pastry, caviar, clamram, clam ram, denby, le creuset, rosle, bourgeat, peugeot, wusthof, henckels, lamson, pg tips, lower cape, route 6a, spode, copper |
| document, apploaderurl, ffffff, location, function, parent, prefix, protocol, apploaderurlstr, typeo f, images, brewster, thetemplate, movetoparent, village, replace, family, helvetica, undefined, cont entbgcolor, backgroundcolor, urllocation, window, footer, 20100430, currentid, 094743, thanksgiving, chances, 1272640756696, utensil, grandmother, setparameter, closed, setsession, christmas, please, toexternalform, requires, script, preloadnaviimages, apploader, ahw050inv9pp, random, adjust, modifi ed, siteprotect, cookcopyright, thesitetree, getparentbyid, swapimage |
| (SLD : cookshopcapecod.com) |
|
| zum Seitenanfang ↑ |
| Gourmet Catalog |
| |
| http://gourmetcatalog.com/ |
| A consumer catalog showcaseing cookware, gadgets, and kitchen accessories. |
| |
| |
| |
| (SLD : gourmetcatalog.com) |
|
| zum Seitenanfang ↑ |
| The Cajun Connection |
| Louisiana Cajun Coffee Products Louisiana Cajun Spices Fragrance Oil Refresher Aquarium Plant For Sale |
| http://www.thecajunconnection.com |
| Features a variety of products from coffees and coffee makers to stainless steel cookware. |
| At The Cajun Connection we have Louisiana Cajun Coffee products for sale, we have Louisiana Cajun sp ices, Fragrance oil refresher, aquarium plant for sale and much more. |
| louisiana cajun coffee products, cajun coffee products, louisiana cajun spices, fragrance oil refres her, live aquarium plant for sale, freshwater aquarium plant, live freshwater aquarium plant, live p ond plant for sale, stainless steel waterless cookware, stainless steel cookware set |
| coffee, chicory, louisiana, community, orleans, supplies, products, upfront, cappuccino, decaffeinat ed, luzianne, registered, french, script, essence, original, aquarium, spices, trademark, emeril, es presso, company, market, machines, shopping, thanks, wisteria, thecajunconnection, thefind, charlie, safari, catalog, friends, cookware, plants, special, nostalgia, pirogue, hunting, basket, beignet, policy, roasted, javascript, information, refresher, seasonings, connection, fragrance, zatarain, cr ystal |
| (SLD : thecajunconnection.com) |
|
| zum Seitenanfang ↑ |
| Oneida |
| Oneida - Bring Life to the Table. |
| http://www.oneida.com/ |
| Offers flatware, dinnerware, crystal and glass drinkware and giftware to the retail, consumer and fo odservice markets. |
| The official Oneida web site. Oneida offers silverware / flatware, dinnerware, drinkware, kitchenwar e and gift ideas to the retail, consumer and food service markets. |
| oneida, onieda, flatware, silverware, dinnerware, drinkware, gifts, wedding, registry, store, buy, r etail, consumer, food service, kitchen, cooking, eating, forks, knives, spoons, plates, oneida silve rware, silverware patterns, |
| document, oneida, window, documentelement, result, function, return, filterresults, resources, displ ay, overlay, clientheight, scrollleft, clientwidth, scrolltop, getelementbyid, import, foodservice, shipping, website, website, purchased, products, account, policy, foodservice, innerheight, pagexoff set, innerwidth, content, oneidaconsumer, pageyoffset, shared, foodservicepopup, modalmasklayer, con tact, locations, policies, popular, information, warranty, international, special, updates, offers, searches, privacy, outlet, affiliate, 338011, affiliates |
oneida.com - rank der domain 197592 (76491 in US)
|
|
| zum Seitenanfang ↑ |
| CMW, Ltd. |
| Kitchen Haven - Kitchen Gadgets, Bakeware, Cookware and more! |
| http://www.kitchenhaven.com/ |
| A supplier of kitchen items for cooking, baking, dining, and entertaining needs. |
| |
| |
| kitchen, cookware, gadgets, bakeware |
| (SLD : kitchenhaven.com) |
|
| zum Seitenanfang ↑ |
| Kitchen and Much More |
| Kitchen Gadgets | Kitchen Storage | Kitchen Organization |
| http://www.kitchenandmuchmore.com |
| Specializes in cookware, small appliances, decorative items, and helpful gadgets for the kitchen. |
| Stock your kitchen with unique kitchen gadgets, kitchen storage and kitchen organizers and low price s. KitchenandMuchMore also offers cookware, bakeware, wine racks, sink accessories and much more. |
| Kitchen Gadgets, Kitchen Storage, Kitchen Organization, Wine Racks, Cookware, bakeware |
| kitchen, document, gadgets, storage, 98your, parameters, outdoor, furniture, pagetracker, ovtacparam found, location, picnic, featured, arrivals, breadcrumb, containerswas, always, covers, insulated, c ooler, taylor, gajshost, typeof, middot, basketyour, service, lineryour, fridgeyour, basket, burner, countertop, window, service, customer, lwparam, kitchenware, parampair, protocol, newsletter, topyo ur, defaulttab, widget, tabbedpanels, savings, clearance, exclusives, weekly, specials, discounts, d ouble, english |
kitchenandmuchmore.com - rank der domain 901478 (0 in US)
|
|
| zum Seitenanfang ↑ |
| Aalto |
| Aalto.com - Alvar Aalto & Aino Aalto Designs | Iittala Aalto Vase, Furniture, Glassware |
| http://www.aalto.com/ |
| Glass tableware and vases, dining and patio furniture, and related accessories. Also offers books ab out the designers. |
| Aalto.com brings you the best works of Finnish designers Aino and Alvar Aalto at low prices - guaran teed. As an authorized iittala and Artek retailer, we offer the largest selection of Aalto designs i n glassware |
| Aalto.com - Alvar Aalto & Aino Aalto Designs | Iittala Aalto Vase, Furniture, Glassware aalto va se, alvar aalto, iittala, aino aalto, iittala glass, aalto furniture, aalto stool, finnish glass, ii ttala glassware, aalto webbing, artek, glass trays, tumblers, trivets, finlandia vase, serving trays , finland |
| shipping, glassware, iittala, factory, iittala, glassblowers, modern, architecture, materials, inter pretations, design, colors, variations, shapes, organic, decide, meticulously, handcraft, legendary, bowlsaalto, decorative, furnitureinspired, product, featured, traysaalto, holdersaalto, designs, fu rniture, vasesaino, candle, glasswareaalto, within, contiguous, states, guests, glassware, timeless, greatest |
| (SLD : aalto.com) |
|
| zum Seitenanfang ↑ |
| US Jesco |
| USJesco.com Innovative Products Online |
| http://www.usjesco.com |
| Provides live product presentations and informercials for innovative home and kitchen products. Incl udes online shopping. |
| Jesco is the industry leader for live product presentations and providing innovative products online . |
| jesco, usjesco, euroclean, euro-gourmet, gourmet quick chopper 2000, food, mr sticky, lint roller, l introller, lightning chopper, mastercut 2 knives, kitchen addition, gourmet cheese mill, magicloth, chamois, mop, microfiber, euroclean, pva mop, static duster, eurosoother massager, eurgourmet, profe ssional cookware, cleaning products, cloths, kitchen, leisure, food processor, carrollton, texas, ap pliances, ltraindesigns, innovative products online, qvc, hgtv, home shopping network, demonstration s, demo, demonstration, infomercial, infomercials, power hour, powerhour, as seen on tv, presentatio ns, e-fomercials, jesco international |
| microfiber, magicloth, cleaning, master, kitchen, cloths, gourmet, knives, shopping, perforated, lig htning, checkout, chamois, euroclean, replacement, slicer, chopper, career, roller, opportunities, w indow, drying, duster, policy, cookware, household, privacy, conditions, sticky, online, products, d esign, around, opportunities, rights, television, international, schedule, reserved, website, copyri ghted, partners, contact, invalid, required, submit, manuals, business, charities, receive, recipes |
usjesco.com - rank der domain 995716 (408596 in US)
|
|
| zum Seitenanfang ↑ |
| Robert Welch |
| Robert Welch UK - Houseware, Cutlery, Glassware and Silverware |
| http://www.welch.co.uk/ |
| Gifts designed by silversmith and craftsman in England. Includes flatware, cookware, jewelry, wine a ccessories, wrought and cast iron. Wedding list registry available. |
| UK based designer of houseware, cutlery, silverware and glassware products, mainly for home use. |
| cutlery, houseware, glassware, silverware, uk, candlesticks, lighting, pewter, giftware, serica, cli pper, childrens giftware, jewellery, tankards, decanters, satin finish, silver plate |
| glassware, silverware, cutlery, houseware, robert |
welch.co.uk - rank der domain 986566 (28955 in GB)
|
|
| zum Seitenanfang ↑ |
| Jensco Inc. |
| TheKitchenDrawer.com by Jensco, Inc. |
| http://www.jensco.com/ |
| Kitchen and baking tools and gadgets, bar and wine accessories. |
| Jensco.com and TheKitchenDrawer.com offer the chef, culinary genius or household cook all the kitche n products they need! This includes kitchen gadgets, cookware, bakeware, baking products, vegetable tools, home decor, household cleaning products, spot removers, specialty and ethnic products, barbec ue, grilling and outdoor products, any almost any kitchen gadget you could ever need! |
| |
| shipping, cleaning, jensco, policy, thekitchendrawer, holders, guardsman, formally, machine, return, privacy, contact, general, ordering, geovisit, checkout, affiliates, request, feedback, product, wi shlist, specials, options, department, products, tableware, ethnic, specialty, closeout, orders, kit chen, departments, shopping, mmloadmenus, bakeware, cookware, outdoor, grilling, utility, cooking, s itemap, clicking, separately, products, navigation |
| (SLD : jensco.com) |
|
| zum Seitenanfang ↑ |
| George Watts & Son, Inc. |
| Shop George Watts Luxury Gifts, Tabletop, Dinnerware, & Gift Registry |
| http://www.georgewatts.com/ |
| Fine kitchenware including table settings, teapots, decorative accessories, and gift items. |
| George Watts & Son is a Luxury Tabletop & Gift Emporium located in Downtown Milwaukee. We've been selling the finest in tabletop products since 1870. Family owned and managed for 5 generations , we are proud to be official authorized dealers for all of the brands we carry. Rest assured that w e will stand behind all of the products we sell. We are the purveyors of fine, rare serving and hom e decor accessories. |
| tabletop, dinnerware, china, giftware, gifts, luxury, glassware, stemware, barware, flatware, silver , crystal, jewelry, home decor, ice buckets, wine decanter, business gifts, corporate gifts, wedding gifts, wine glasses, bottle openers, serving platters |
| document, pagetracker, unescape, javascript, 3cscript, script, gajshost, location, protocol, george, import, georgewatts, registry, jsfile, includejavascript, serversserving, setssectional, pepper, we ightssalt, accessoriestea, coffee, servicetiered, bowlsflatwarecasualflatware, shakersopeners, serve rscocktail, stopperscoasters, accessoriesbottle, serving, platters, servewarenapkin, chestsformal, s ervers, kitchenaccessoriesapronscookwarecutleryknivesknife, carafes, accessoriesbar, setssharpenerss teak, blocks, grinderstools, stemwarecasualformal, casseroles, platestureens, linensnapkin, ringsnap kinsplacematstable, pitchers, collections, analytics, google, gettracker, brokenimage, engine, luxur y |
georgewatts.com - rank der domain 984459 (417374 in US)
|
|
| zum Seitenanfang ↑ |
| Pfaltzgraff |
| Dinnerware Sets, Stoneware, Tableware, Kitchenware, Plates | Pfaltzgraff |
| http://www.pfaltzgraff.com/ |
| Manufacturers and markets casual dinnerware, flatware, accessories and gifts since 1811. Features on line ordering, specials, pattern locator, history, and registry. |
| Buy dinnerware and tableware direct from the official online Pfaltzgraff store. Shop and save on fla tware, plates, serveware, and kitchen textiles. |
| Dinnerware, Dinnerware Sets, Tableware, gadgets, accessories, chefs, cookware, bakeware, utensils, t ools, plates, dishes, cups, flatware, cutlery, trays, platters, plfaltzgraff, discount, entertaining , sets, kitchen, dinner, kitchenware, stoneware, dinnerware, stonewares, online, sale, collection, p attern, holiday, seasonal, christmas, bone china, china, earthenware, porcelain |
| flatware, function, dinnerware, collections, patterns, kitchen, drinkware, linens, serveware, access ories, pfaltzgraff, jquery, popupcontent, default, categorynavigation, stoneware, categorystyle, pla tes, bottles, minicart, demandware, outdoor, display, parseint, document, cutlery, countertop, spice s, addclass, paddingleft, paddingright, parent, safari, holders, specialty, placemats, cloths, bakew are, runners, towels, cookware, cleaner, categorymenu, kitchenware, superfish, clearance, specials, autoarrows, tableware, devicepixelratio, dropshadows |
pfaltzgraff.com - rank der domain 84662 (32295 in US)
|
|
| zum Seitenanfang ↑ |
| Vacuums Unlimited |
| HomeWerks San Antonio - Unique Items for your Home |
| http://www.homewerkscoolstuff.com/ |
| Vacuums, vapor systems, sound systems, irons, intercoms, and appliances. Feedback section for vacuum questions. Service available in San Antonio. |
| Unique items for your home. Homewerks in San Antonio offers vacuum cleaners, home cleaning, cooking appliances and more items your home. |
| homewerks floor care, homeworks, cookware san antonio, bakeware san antonio, laundry san antonio, co ffee systems san antonio, appliances san antonio, indoor air, outdoor kitchens san antonio, untensil s cutlery, indoor air, vacuum cleaners, top rated vacuums, powerful vacuum cleaners, Miele vacuum cl eaners, Mieles, Miele vacuum cleaner, Miele, authorized Miele dealer, homewares, household, cleaning things, steamers, steam cleaners, vapor steamers, Euro Pro, vapor steam cleaners, Ladybug, TidyVaps , lady bug, ladybug steamers, household steam cleaners, chemical free cleaning, Miele vacuums, Miele , Miele dealer, Vacuum cleaners, vapor steamers, vapor steam cleaners, Miele, vacuum cleaners, vacuu ms, household, home vacuums, Miele, Vacuum cleaners homewerks |
| denise, securities, outdoor, kitchenssounds, systems, cleaners, coffee, events, selectcapressoemile, please, henryiqairiron, waylaurastarmieler, manufacturers, twitter, registry, certificate, contact, facebook, kitchen, catalog, categories, homewerks, antonio, unique, appliances, countertop, laundry , appliancesindoor, cutlery, cookware, bakeware, utensils |
| (SLD : homewerkscoolstuff.com) |
|
| zum Seitenanfang ↑ |
| Register Equipment Company, Inc. |
| host.yoursoftdns9.com |
| http://mr55.com |
| Provides a range of brand name products including Saeco espresso, Bunn coffee makers, John Boos, War ing, Stainless steel tables, and Mundial knives. |
| online sales of Vita Mix Blenders,Waring blenders,Hamilton Beach blenders, bar blenders,home blender s,drink machines,ice cream mixers,bunn coffee makers,lazy man grills,stainless steel grills,outdoor grills,barbecue,grills,gas grills,professional equipment, saeco espresso makers,Capresso espresso, c hafing dishes, John boos tables, butcher blocks,sharp,microwave ovens,sharp microwaves and steak kni ves |
| Vita Mix Blenders,Waring Bar blenders,bar blenders,hamilton beach blenders,bunn coffee makers, home blenders, drink machines,ice cream mixers,stainless steel grills,chafing dishes, catering supplies, outdoor grills, barbecue, grills, stainless steel, gas grills, professional equipment, saeco espres so makers, steak knives, outback knives |
| specialsspecial, inventory, delivered, overstock, knives, 9990click, yoursoftdns9, browse, storescal l, online |
| (SLD : mr55.com) |
|
| zum Seitenanfang ↑ |
| Weston Supply |
| |
| http://www.westonsupply.com/ |
| Food processing equipment including meat grinders, grain mills, butchering tools, sausage and jerky supplies, and related books and videos. |
| |
| |
| classname, function, selected, window, location, breadcrumb, getelementsbytagname, getattribute, mak ing, equipment, supplies, packaging, vacuum, sealers, preserve, slicers, kitchen, baking, gadgets, b urger, presses, welcome, westonsupply, perhaps, iepngfix, volusion, mailing, behavior, juicers, proc ess, status, grinders, specials, contact, customer, service, accessories, sausage, makers, dehydrato rs, smokers, prepare, processing |
westonsupply.com - rank der domain 991337 (406217 in US)
|
|
| zum Seitenanfang ↑ |
| Holland Bowl Mill |
| |
| http://www.hollandbowlmill.com |
| Produces and sells handcrafted solid wood turned bowls, cutting boards and utensils, and a food safe wood preserver. Wholesale and retail prices available. |
| |
| |
| |
| (SLD : hollandbowlmill.com) |
|
| zum Seitenanfang ↑ |
| Kasbahouse.com |
| Villaware italian kitchenware, joyce Chen, vilaware, home products,
pizelle, waffles for sale, La Pavoni, CucinaPro, Zyliss |
| http://www.kasbahouse.com/ |
| Villaware and Joyce Chen kitchenware, plus home decor and world handicrafts. |
| kitchenware housewares |
| |
| images, preloadimages, zyliss, copyright, bottom, cucinapro, credits, kitchenware, italian, villawar e, vilaware, waffles, pizelle, products, pavoni |
kasbahouse.com - rank der domain 976480 (412795 in US)
|
|
| zum Seitenanfang ↑ |
| StudioLX |
| StudioLX - Home Decor, Acrylic Furniture, Wall Decor, Espresso Machines |
| http://www.studiolx.com |
| Offers European porcelain tea, coffee, and espresso sets. Also offers decorative and modern glass va ses, bowls, and platters. |
| StudioLX offers fine home decor, upscale kitchenware and tabletop products. Espresso machines, tea s ets, coffee sets, glass vases and much more. |
| home decor, tableware, small kitchen appliances, dinnerware, tea sets, glass vases, coffee sets, are a rugs, glassware, espresso sets, tall vases, wall decor, decorative vases, colored glass vases, orn amental vases, ceramic vases, ceramic bowls, centerpieces, glass bowls, gift sets, art glass, espres so machines, grinders, acrylic furniture, coffee grinders, press pots, stove tops, ceramic platters |
| analytics, ystore, espresso, coffee, deluxe, ywatracker, lovers, baskets, cheese, picnic, items2, ac cessories, items3, machinescoffee, window, caseswine, backpackspicnic, coffeesespresso, espresso, ba sketspicnic, acrylic, makerscoffee, kitchen, brewersgift, coffee, collection, grindersstove, topspre ss, domain, generated, ground, machines, machinegourmet, pasteitem, setstea, entire, items1, domains , docname, collections, project, beacon, docgroup, furniture, topsgourmet, brewersstove, grinders, t easgourmet, coffeesgift, extraspress, should |
studiolx.com - rank der domain 980762 (424803 in US)
|
|
| zum Seitenanfang ↑ |
| Synergy Computing Business Group, Inc. |
| All Clad Cookware, Gourmet cookware, Cutlery, Shun Knives, Wusthof Knives Global Knives, Le Creuset, and More . |
| http://www.chefsresource.com |
| Includes Kyocera ceramic knives, herb and spice grinders, Riedel wine glasses, specialized kitchen f urniture and cutting boards, and cookware. |
| |
| All-Clad, all clad, DeLonghi, Edgecraft, cooking, allclad, cutlery, cookware, baking, bakeware, chef , store, shopping, menu, pot, pan, pots, pans, appliance, knives, ceramic, cutlery, peeler, gadget, cookbook, Riedel, Cuisinart, kitchen, culinary, gourmet, rosle, Emile Henry, Calphalon, Chef's Choi ce, Le Creuset, Villaware, Hamilton Beach Commercial, BBQ, kitchen gadgets, epicurean, wine glasses, BBQ, BBQ tools, AMCO, microplane, cambro, lamson, misto, salter, Kuhn Rikon, pressure cooker, Kyoce ra, La Forme, Matfer, wusthof, global |
| analytics, ystore, knives, border, padding, ywatracker, background, window, ffffff, generated, creus et, domain, living, decoration, outdoor, domains, docgroup, resource, serious, docname, project, bea con, wusthof, global, cutlery, verdana, helvetica, center, cookware, gourmet, 3d4117626642, 3dc2vydm vjzd0icut1sul0r19rahu1n0tzefb3uvjzd0m4vgk0dndreeporkvbqw1osyigc2l0zulkpsi0ndy2ntuxiib0u3rtcd0imti3ot g2ntkznze2odg5msig, wedding, registry, 3d1b42bfd1, create, family, moments, create, friends, setdocu mentname, setdocumentgroup, gettracker, 3d1279865937, 17q8hqpse, qhu57ksxpwqrswc8ti4vwkxjnfeaamnk, s etcookiedomain, document, submit, setdomains, function |
chefsresource.com - rank der domain 314289 (125519 in US)
|
|
| zum Seitenanfang ↑ |
| Heslops Corporation - Barron's Catalog |
| Home Decor, Dinnerware, Collectibles, Gifts from Barrons Catalog |
| http://www.barronscatalog.com/ |
| Dinnerware, giftware, collectibles, and home decor items. Order online from your Barron's catalogs. |
| Find classic home decor, lighting, home accents, clocks, china, crystal, flatware, table accessories , holiday ornaments, collectibles and seasonal gifts at Barrons Catalog |
| Barrons Catalog, crystal, china, flatware, ornaments, porcelain, figurines, collectibles, ceramic, s terling silver, clocks, table accessories, serveware, jewelry, wall decor, lamps, lighting, tea sets , baby and kids gifts, wedding, outdoor decor, home accents, accent furniture, rooster, seasonal gif ts, nativity, Christmas ornaments, holiday, area rugs, outlet, glassware, cookie jars, canister sets . |
| showmenu, barronscatalog, category, tabletop, collectibles, seasonal, lighting, milonic, menuname, j ewelry, menustyle0, milonic, outlet, keyword, return, accents, decorative, jewelry, searchterms, sea sonal, decorative, borderwidth, offset, onclass, offclass, bordercolor, borderstyle, lighting, accen ts, barrons, remain, copyright, solutions, problem, document, lladro, clocks, brands, itemwidth, a7a 7a7, swarovski, pagetracker, catalog, products, accessories, nosearchterm, collectibles, function, d efaulttext, minkeywordlength, menuitemoff |
barronscatalog.com - rank der domain 891178 (381063 in US)
|
|
| zum Seitenanfang ↑ |
| Best Crystal |
| Waterford, Wedgwood, Nambe, Orrefors, Kosta Boda, Lladro, Lenox - Crystal, China, Flatware |
| http://www.bestcrystal.com/ |
| Offers Waterford, Nambe and Vera Wang crystal, china, ornaments, stemware, lamps and chandeliers. |
| Waterford Crystal & China, Wedgwood China, Lenox China, Nambe, Vera Wang China & Crystal, Waterford Chandeliers & Lamps at Best Crystal |
| waterford crystal, waterford china, nambe, lenox china, wedgwood china, vera wang china, vera wang c rystal, waterford lamps, waterford chandeliers, waterford christmas ornaments |
| waterford, crystal, wedgwood, flatware, silver, christmas, orrefors, flutes, document, registered, g lasses, retailer, collection, trademark, doulton, stemware, ornaments, marquis, specials, microsoft, barware, adcenterconversion, thomas, frames, business, martini, champagne, clocks, collectibles, re ligious, candleholders, toasting, chandeliers, glassware, tableware, limited, kilbarry, shopping, hi story, parent, frames, authorized, location, ireland, substring, pagetracker, monday, gajshost, mich ael, lladro, function |
bestcrystal.com - rank der domain 988450 (411376 in US)
|
|
| zum Seitenanfang ↑ |
| purple-eggplant |
| Welcome to Aubergine |
| http://www.purple-eggplant.com/ |
| Offers kitchenware, glasses, gifts, gourmet foods, and collectibles. |
| Welcome to Aubergine - Inspiration for the Kitchen in Woodstock, Vermont. Great Gifts Gourmet Foods Kitchenware Vermont Products Home Decor Books Tabletop, shop, online shopping, Woodstock Vermont, k itchen store |
| Great Gifts Gourmet Foods Kitchenware Vermont Products Home Decor Books Tabletop Clearance ecommerce , open source, shop, online shopping, Woodstock Vermont, kitchen store, Catherine Hunter Poules, Cat herine Hunter Chickens, Vietri, Vance Kittira, Baggalini, Old World Santas, Guniea Hens, Cow Parade, Nepsresso, Peugeot, JK Adams, |
| document, pagetracker, gajshost, javascript, gettracker, trackpageview, 3360071, script, google, pro tocol, location, aubergine, welcome, analytics, 3cscript, unescape |
| (SLD : purple-eggplant.com) |
|
| zum Seitenanfang ↑ |
| Wares of Knutsford |
| Kilner Jars, Jam Jars, Glass Bottles, Mason Cash, Plastic Bottles, Preserving Jars |
| http://www.waresofknutsford.co.uk/ |
| Offers traditional hardware such as kitchenwares, cookware, enamelware, pottery and household. |
| Buy jam jars, kilner jars, swing stopper bottles & Mason Cash kitchenware. New this year - aroma therapy bottles, cosmetic jars & a wider range of preserving jars and bottles. |
| kitchenware, jam jars, kilner jars, cake tins, preserving jars, baking tins, uk |
| bottles, images, mouseovers, bottles, preserving, traditional, including, popular, wholesale, equipm ent, preserving, document, gaskell, contact, browse, viewshoppingbasket, aboutwares, kilner, myshopp ingbasket, orderform, knutsford, dishes, baking, enamelware, selection, section, customers, basins, kitchen, making, plastic, square, plastic, pottery, topdeck, collection, funnels, storage, straining , labels, pudding, ranges, hangers, recipes, polishes, wooden, shapes, hexagonal, pickling, accessor ies, provide |
waresofknutsford.co.uk - rank der domain 959550 (6671 in UK)
|
|
| zum Seitenanfang ↑ |
| Chef Gadget |
| Chefgadget.com: Kitchen Gadgets and Culinary Ware |
| http://www.chefgadget.com |
| Offers large selection of kitchenware, cookware, bakeware, kitchen utensils and culinary gifts. |
| Chefgadget specializes in high-end, high quality, Kitchen Gadget and Culinary
Ware. Ever ything for the chef from Aprons to Whisks, Hundreds of Bakeware, Cookware, Slicers, Mills,
Cake Molds, Spring Forms, and Kitchen Accessories. Plus Free Shipping on orders over 0. |
| bakeware,cookware,slicer,chef tool,bar tool,dessert tool,food mill,rolling pin,
barbeque, bbq,fish tool,meat tool,pasta tool,serving utensil,electric kitchen,kitchen accessories,
chef gifts,mom gift,dad gift,cook gift,gift |
| window, document, searchfrm, parseint, windowheight, windowwidth, function, prodwidth, prodheight, r eturn, selectbrand, please, brands, prodname, closed, photoheight, photowidth, photoname, toolbars, height, swapimgrestore, gadgets, brands, kitchen, chefgadget, select, showpic, scrollbars, prodwindo w, photowindow, showprod, culinary, keyword |
| (SLD : chefgadget.com) |
|
| zum Seitenanfang ↑ |
| CookingToys |
| CookingToys.com - Juicers, Blenders, Cutlery, Kitchen Gadgets and More! |
| http://www.cookingtoys.com/ |
| Offers coffee makers, cutlery and knives, pressure cooker, cookware, gadgets, tumblers and glassware . |
| |
| |
| document, cookies, indexof, tervis, cartvalues, juicer, substring, kitchen, juicers, linecount, tumb ler, tumblers, cookie, blenders, dehydrator, excalibur, healthy, pagetracker, makers, cookingtoys, r espective, product, customer, privacy, unescape, dehydrators, designs, gadgets, brands, cutlery, pro perty, represented, policy, gajshost, tribest, featured, brands, categories, output, start1, informa tion, rachael, harvester, american, samson, thermo, exclusives, miracle, metrokane, vitamix, wilton |
| (SLD : cookingtoys.com) |
|
| zum Seitenanfang ↑ |
| Digi Resources LLC |
| DigitalKitchenStore.com Kitchen & Gourmet, Gifts for Her, Gift for Him, Kitchen Gifts, Fine Wall Art |
| http://www.digitalkitchenstore.com |
| Retailers of cookware, kitchen accessories, small appliances and home electronics. |
| DigitalKitchenStore.com - Search Our Store: Find the Best for Holiday Entertaining & Gift Giving !The best parties and entertaining seem effortless. Need the perfect Gift? Look to our Gift ... |
| DigitalKitchenStore.com gifts for her, gifts for him, kitchen gifts, saeco coffee, pasta machine, kitchen gifts, houseware gifts, kitchen gift |
| analytics, ystore, ywatracker, window, kitchen, document, domain, generated, gourmet, project, docgr oup, control, trainsremote, toyslionel, toyshalex, regent, 49homedics, domains, indoor, turntoconfig , crosse, status, tracking, celebrity, digitalkitchenstore, docname, beauty, cleanerswardrobe, groom ingmirrorsfoot, paraffin, lighting, vacuums, garment, cookwarecookware, preparation, quality, beacon , carehair, satellite, nature, backpacksclick, chaney, testimonials, carriers, 95feedback, soundscli ck, monitor, picnic, thermometerclick, copper, porthole |
| (SLD : digitalkitchenstore.com) |
|
| zum Seitenanfang ↑ |
| Cookware & More |
| Cookware & More : Selling All Clad Irregulars Since 1984 |
| http://www.cookwarenmore.com |
| Offers wide selection of products such as cookware, cutlery, cutting boards, bakeware, pot packs, ki tchen tools and pressure cookers. |
| Cookware & More : Selling All Clad Irregulars Since 1984 |
| All-Clad cookware, All-Clad, All-Clad COP-R-Chef, All-Clad Copper Core, All-Clad First Quality, All- Clad LTD, All-Clad Master-Chef 2, All-Clad Outlet, All-Clad Stainless, All-Clad bakeware, All-Clad i rregulars, allclad, all clad |
| outlet, retail, cookware, selling, irregulars |
| (SLD : cookwarenmore.com) |
|
| zum Seitenanfang ↑ |
| More than Kitchen |
| MoreThanKitchen - European Cookware, Bakeware from WMF, Swiss Diamond, Fissler, Kaiser, Peugeot |
| http://www.morethankitchen.com |
| Offers European kitchen accessories, gourmet cookware, kitchen gadgets, espresso machines and cups. |
| MoreThanKitchen - European Cookware, Bakeware from WMF, Swiss Diamond, Fissler, Kaiser, Peugeot. Mor eThanKitchen offers products for the Kitchen. Cookware, Bakeware, Kitchengadgets, Tabletops, Cutlery , Salt and Pepper Mills. Most items are made in Germany, made in Switzerland, made in France, made i n Italy, and made in USA. Free shipping over . |
| European, WMF, Swiss Diamond, Fissler, Kaiser, Peugeot, messermeister, wenger, Cookware, Bakeware, K itchengadgets, Tabletops, Cutlery, Salt and Pepper Mills, made in Germany, made in Switzerland, made in France, made in Italy, made in USA, children's flatware, cooking with children, |
| cookware, espresso, machines, raclette, middot, diamond, height, bakeware, family, normal, fondue, 4 0446d, verdana, espresso, decoration, gaggia, cookware, knives, fissler, margin, border, 000000, gad gets, switzerland, kaiser, shipping, peugeot, background, cheese, wenger, children, corner, kitchen, accessories, cutlery, handpresso, germany, messermeister, swissmar, trudeau, machine, melter, peppe r, tabletop, barware, padding, raclette, contact, bottom, products, product |
| (SLD : morethankitchen.com) |
|
| zum Seitenanfang ↑ |
| Cox County Gifts |
| Cox Country Gifts |
| http://www.coxcountrygifts.com/ |
| Specializes in splatter ware, cookware, linen and enamel dishes. |
| |
| |
| online, orders, taking, inconvience, notified, resume, appreciate, ff0000, background, country, ffff 99, business, greatly |
| (SLD : coxcountrygifts.com) |
|
| zum Seitenanfang ↑ |
| Canning Pantry |
| |
| http://www.canningpantry.com/ |
| Offering canning supplies, canning equipment, pressure cookers, small appliance, and shaved ice mach ines. |
| |
| |
| |
canningpantry.com - rank der domain 879387 (361280 in US)
|
|
| zum Seitenanfang ↑ |
| Armorica |
| Armorica Online Cookshop - cookware, kitchenware, and kitchen equipment |
| http://www.armorica.co.uk |
| Offers cookware such as pots and pans, utensils, tabletop, knives, appliances, barware and cook furn iture. |
| Armorica UK cookshop, selling cookware, kitchenware and kitchen equipment from all leading brands in cluding Demeyere, SKK, Wusthof, Sabatier, Porsche, Revival, Mauviel, Chausseur, Berndes, Pillivuyt, Jura, Henckel, Global, Hahn, Copperbrill, Alan Silverwood, La Pentole, Zyliss, Fissler, Rosle, Eva S olo, and Tefal. |
| armorica, cookware, kitchenware, kitchen equipment, online cookshop, kitchen appliances, demeyere, s kk, mauviel, chausseur, berndes, pillivuyt, jura coffe machines, henckels knives, global knives, hah n, copperbrill, alan silverwood, kitchen trolley, waring juicers, la pentole, zyliss, fissler, rosle , eva solo, tefal raclette, Petersfield, Hampshire |
| knives, cookware, kasumi, armorica, cooking, dualit, paella, tojiro, kitchen, damascus, accessories, global, ceramic, stellar, professional, serious, cupcake, gajshost, pagetracker, document, coloured , toaster, newsletter, prices, electrical, basket, buyers, cookshop, recipes, specials, toasters, ch arcoal, picnic, fyrkat, tricks, tagine, tasting, moroccan, external, toasters, advice, offers, tagin e, address, stands, analytics, google, 3cscript, unescape, javascript, 15348073 |
armorica.co.uk - rank der domain 949535 (6264 in UK)
|
|
| zum Seitenanfang ↑ |
| Steamer Inn |
| Steamer Trading Cookshops Sussex :: home page |
| http://www.steamer.co.uk/ |
| Offers a wide range of kitchenware like cookware, kitchen basics such as saucepans, knives. Also pro vides appliances and coffee machines. |
| |
| stores, listings, contact, details, storesclick, nearest, store, steamer, uncovered, calendar, 2004, famous, buy, onlineclick, order, coming, trading, comes, westerham, kent, easterclick, read, shop, showimage, welcome, cookshop, family, run, award, winning, kitchenware, specialist, based, south, en gland, |
| templates, homepagenew, sitestyle, steamer, stores, trading, imagesarray, office, england, winning, cookshop, family, specialist, kitchenware, celebrated, edmunds, opened, saffron, outlet, opening, wa lden, achieved, welcome, becoming, number, contact, random, randomnumber, homepg8, homepg7, length, runflcontentx, document, homepg6, homepg5, showimage, pagefunction, sussex, cookshops, homepg4, home pg3, homepg2, homepg1, allowscriptaccess, samedomain, wedding, products, careers, installed, switch, middle |
steamer.co.uk - rank der domain 996797 (30819 in GB)
|
|
| zum Seitenanfang ↑ |
| Hurting Head Creations |
| Welcome to Hurting Head Creations |
| http://hurtinghead.tripod.com |
| Offers wine glasses, silverware, cutlery, and placeholders. |
| |
| crafting, wedding, bride, bridal, graduation, birthday, nuptials, wine, champagne, betrothed, engage d, shower, shower gift, housewarming, housewarming present, housewarming gift, welcome, cocktail, co cktail party, cocktails, wine glass charms, charms, wire, goblet, flute, celebrate, christmas gift, christmas, present, hanukkah, chanukah, silverware, tableware, gourmet, place settings, dinner, dinn er party, dinner parties,custom design, custom-designed, wine, champagne, chalice, toast, toasting, bride and groom, bride, groom, toasting the bride and groomgifts, presents, crafts, glass, beads, we dding gifts, birthday gifts, christmas gifts, wine, champagne, napkin rings, placeholders, wine glas ses, champagne glasses, glassware |
| height, background, social, position, images, repeat, important, window, search, container, margin, document, button, display, padding, jquery, tripod, category, decoration, section, function, relativ e, adbanner, onbutton, documentelement, sprite, onshare, onsearch, animate, return, setforcedparam, clientwidth, clientheight, normal, hidden, center, cursor, absolute, overflow, hosted, member, repla ce, contain, family, helvetica, underline, weight, pointer, leaderboard2, served, remove |
tripod.com - rank der domain 857 (45 in JP)
|
|
| zum Seitenanfang ↑ |
| Harlequin Tabletop |
| Harlequin Tabletop |
| http://www.harlequintabletop.com |
| Specialized in porcelain, crystal, silver, decorative objects, flatware, oven to table ware, kitchen ware and bespoke design. |
| Harlequin Tabletop quality tableware |
| fine tableware glassware china vases cutlery |
| function, harlequin, brands, tabletop, document, interior, messages, product, access, international, gajshost, providing, website, return, designers, newsletter, regular, script, online, pagetracker, duration, london, developed, exclusively, clients, products, account, extensive, michael, redloh, la test, launches, fulham, jquery, javascript, analytics, 3cscript, google, trackpageview, 10837708, ge ttracker, unescape, technology, enquiries, harlequintabletop, onemanwebdesign, protocol, location, s uperfish, industry, 97ca00 |
| (SLD : harlequintabletop.com) |
|
| zum Seitenanfang ↑ |
| The Studio |
| Gifts, cookware, kitchenware, glassware, dinnerware, linen, cutlery |
| http://www.thestudio.co.nz |
| Offers tableware such as dinnerware, cutlery, glassware, table linen, and kitchenware from New Zeala nd. |
| For gifts, cookware, glassware, dinnerware, cutlery, linen & more. The Studio of Tableware have an unrivalled range of quality brands: Christofle, WMF, Rosenthal.. |
| |
| kitchen, conran, assorted, scales, cookware, vivendi, position, cutlery, children, height, kitchenwa re, coffee, utensils, giftware, reg411, absolute, dinnerware, barware, cookware, glassware, sophie, accessories, bathroom, silver, cutlery, tableware, glassware, dinnerware, platinum, abacus, botanic, serveware, classic, jasper, bernardaud, cornish, pomona, toiletries, garden, standard, martin, mode rn, riedel, kettles, appliances, vazrani, makers, saturn, essence, christofle, blankets |
| (SLD : co.nz) |
|
| zum Seitenanfang ↑ |
| Incantation |
| Incantation |
| http://www.incantation-online.co.uk |
| A collection of Colombian clay cookware products such as pots, oven dishes and bowls. Also provides handbags. |
| |
| |
| incantation |
| (SLD : incantation-online.co.uk) |
|
| zum Seitenanfang ↑ |
| Home Preparation Corporation |
| HPC - Home Preparations Company |
| http://www.homepreparations.com |
| Offers housewares such as dinnerware, bath accessories and home lighting products. |
| Home Preparations Company (HPC)is founded on the principle that home decor should be exceptional in style and quality while being affordable. We are dedicated to bringing you the very best in designer homewares and gifts. Unlike the "Mega-Store" sites, we offer exceptional and personalized service. We value your business, and want to make your HPC experience a memorable one. We feature i nnovative and stylish products from Red Vanilla and Rhubarb. |
| Homepreparations, home preparations, Rhubarb, housewares, ornaments, vases, bathroom, lamps, accesso ry, accessories, gift, gifts, organize, organizers, dinnerware, stainless, mikasa, table top, glass, coupon, stemware, barware,redvanilla, vanilla, red, red vanilla, china,bone,bone china, sets, sets, pure vanilla |
| decoration, 000000, family, buttons1397564, padding, underline, ffffff, background, emergency, anyon e, special, contact, decorating, preparations, requests, appreciate, sister, entertain, elements, em ergency, before, hurricane, perfect, preparation, certificates, preparations, occasion, homepreparat ions, comfor, information, contact, please, purchase, pricing, discounts, confidence, prices, produc ts, submitcount, function, submitform, return, accomodate, interested, becoming, distributor, states , addresses, outside, united, bottom |
| (SLD : homepreparations.com) |
|
| zum Seitenanfang ↑ |
| Kings and Queens |
| Discount Portmeirion Pottery |
| http://www.kingsandqueenswales.com |
| Specialized in Portmeirion pottery tableware, serving pieces, cookware, storage, glasses and cutlery . |
| Portmeirion Pottery From Kings and Queens |
| Portmeirion,Discount Portmeirion,portmeirion pottery,portmeirion china,portmerion,portmeiron,botanic garden,pomona,strawberry fair,dusk,pearlescent glass,holly and ivy,mugs,soho,splat,christmas story, xmas story,botanic roses,apple harvest,gingko,botanic blue,crazy daisy,sophie conran,up the garden p ath,tracy beaker. |
| retirements, coasters, tableware, tablemats, ceramics, portmeirion, plates, serving, normal, cookwar e, giftware, cutlery, placemats, window, document, botanic, textiles, pagetracker, pieces, piecees, gajshost, storage, garden, accessories, weight, helvetica, height, family, sidebar, padding, margin, christmas, romancenew, conran, hungry, celadon, forget, caterpillar, candles, lucynew, 3cscript, un escape, google, analytics, location, kingsandqueenswales, protocol, gettracker, 3847106, initdata, t rackpageview |
| (SLD : kingsandqueenswales.com) |
|
| zum Seitenanfang ↑ |
| Rob McIntosh |
| Rob McIntosh China, Crystal, Tableware, Collectibles, Fine Gift Shops and Bridal Registry |
| http://www.robmcintoshchina.com/ |
| Offers fine china, crystal, flatware, porcelain and gift retail chain. Includes a bridal registry, s tore locations and services information. |
| Rob McIntosh China and Crystal Shops and Bridal Registry is Canada's leading supplier of dinnerware, silver and stainless flatware (cutlery), stemware (glassware), porcelain and gifts, including colle ctor plates, figurines, dolls and teddies. |
| Dinnerware, tableware, fine china, bone china, porcelain, stemware, crystal, glassware, flatware, st ainless flatware, silver flatware, cutlery, collectibles, collector plates, giftware, gifts, corpora te gifts, Canada's bridal registry, pinwheel |
| registry, collectibles, patterns, security, discontinued, wedding, general, privacy, wholesale, cust omers, shipping, bridal, tableware, mcintosh, crystal, dinnerware, corporate, specials, products, ce rtificates, gourmet, stemware, flatware, giftware, kitchen |
| (SLD : robmcintoshchina.com) |
|
| zum Seitenanfang ↑ |
| Bshl |
| Catering Equipment by BSLH |
| http://www.bslh.net/ |
| Offers stainless steel cutlery, knives, cookware, plates and kitchenware. |
| We supply catering equipment at great prices with a personal service. Our goal is to provide the pro fessional caterer with the best value products on the market. We stock commercial food service items from the most trusted manufacturers and we also provide catering equipment leasing to help spread t he cost. |
| catering equipment, kitchen, commercial, uk, trays, refrigeration, cookware, cutlery, tableware, sup plies |
| catering, machines, products, equipment, service, equipment, catering, please, cutlery, beverage, pr ovide, professional, cleaning, prices, quality, caterer, invoice, kitchen, furniture, kitchenware, g astronorm, storage, deliware, knives, utensils, document, cutlery, silver, freezers, trolleys, chafi ng, computer, purchase, gajshost, pagetracker, crockery, chillers, manufacturers, service, clothing, counters, bakeware, barware, dishwashers, products, maries, screen, protect, potato, following, buf fetware |
| (SLD : bslh.net) |
|
| zum Seitenanfang ↑ |
| From the Hearth |
| From the Hearth offers gourmet foods, kitchenware, culinary items and fresh seafood. Browse our fine selection of cookbooks, bakeware, dinnerware, fine china and wine & beer accessories - Kitchenware, cookbooks, marble kitchen accessory |
| http://www.fromthehearth.com |
| Offers cookbooks and culinary items such as kitchenware, tabletop, dinnerware and cookware. |
| Quality Household kitchen accessories, stainless steel cookware, cutlery, copper cookware, flatware, dinnerware, fine china, wine and beer accessories |
| bakers rack,bakeware,champagne marble,cheese spreader,chrome accessories,cookware,cookbook,cookbooks ,copper kitchen accessories,copper cookware,copper kitchenware,Cutlery,cutting board,peppermill,pepp er mill,kitchen island, dinnerware,dinnerware sets,dishes,earthenware,fine china,flatware,fondue pot ,fresh fish,fresh seafood,fry pan,fund raising,fundraising,giftware,gourmet foods,green marble acces sories,housewares,Italian Cookbook,kitchen gifts,kitchenware,lasagna pan,lazy susan,Lynns Concepts d innerware,marble kitchen accessories,mixing bowls,Old Dutch Copper,pastry board,percolator,plate rac k,Polish Cookbook,pot rack,pots,roasters,serving boards,serving trays,servingware,stainless steel co okware,teapots,tea kettles,Tramontina cookware,Tramontina cutlery,Tramontina knives,white marble acc essories,wine accessory,wine butler,wine charms,wine opener,wine racks,wine stopper,wedding accessor ies,unity candles,wedding gifts,wedding invitations |
| expedited, hearth, 1553360, merchandise, policy, please, return, mailing, thispage, products, cookbo oks, darien, kitchenware, sussex, delivery, fromthehearth, business, company, please, receive, other wise, contact, correspondence, telephone, blocked, refund, unless, rather, process, orders, otherwis e, specified, builder, website, ecommerce, website, design, ebizwebpages, accomodate, volume, purcha ses, powered, guarantee, product, receipt, return, shipping, handling, request, service, ground |
| (SLD : fromthehearth.com) |
|
| zum Seitenanfang ↑ |
| Cutlery and More |
| cutleryandmore.com - Wusthof, All-Clad Cookware, Shun Knives, Henckels, Calphalon, Le Creuset, Breville & Cuisinart Small Appliances |
| http://www.cutleryandmore.com |
| Offers professional knives and cutlery, cookware, cook's tools, kitchen carts and electrics. |
| We carry a full selection of kitchen knives, cookware, small appliances and kitchen tools. Brands li ke Wusthof, Henckels, All-Clad, Calphalon, Le Creuset, Breville Small Appliances & Cuisinart. |
| cookware, cutlery, small appliances, kitchen electrics, wusthof, henckels, all clad cookware, le cre uset, calphalon, cuisinart, breville, capresso, krups, chef's choice, shun knives |
| decoration, active, visited, topbar, ffffcc, 000000, knives, 333399, sidebar, upfront, chicago, unde rline, capresso, wusthof, calphalon, cookware, henckels, creuset, cuisinart, defaulttxt, breville, s crewpull, silpat, scanpan, sirman, salter, swissmar, taylor, tojiro, diamond, peppermate, microplane , france, metrokane, messermeister, marcus, masahiro, mauviel, mundial, nordicware, peugeot, polder, proteak, totally, norpro, norton, rachael, cladbrevillecalphaloncapressochef, schoicecuisinarthenck elskrupsle, brands, knivesfeatured |
cutleryandmore.com - rank der domain 83363 (32829 in US)
|
|
| zum Seitenanfang ↑ |
| Perfect Peninsula |
| Distributors for preethi mixie, sharp wet grinder, nirlep cookware, Cutting Edge microwave idli cookers, Akshaya electric idli Steamers and Cookware, dry, wet grinders, mixer grinder, indian mixie, 110 volts, tabletop, countertop, tilting models |
| http://www.perfectpeninsula.com |
| Offers Indian kitchen appliances and cookware. |
| Home for nirlep cookware, preethi, preethi mixie, santha dry, wet grinder, with 110 volts in tableto p, countertop, tilting models and act as blender, mixer for all options in your kitchen |
| nirlep, preethi, preethi mixie, sharp, santha, wet grinder, idli grinder, heavy duty mixie, mixer, b lender, 110 volts, ultra, modern, kitchen, indian appliance, cookware, food processor, dry, wet, ind ia |
| cookware, pressure, akshaya, stainless, pritam, cookers, anodized, premier, nirlep, perfect, preethi , steamers, kitchen, microwave, cooker, griddle, little, giftsets, plates, paniyaram, aluminum, coco nut, accessories, bottom, grater, grinder, aluminium, enamelware, virgin, litres, steamer, peninsula , appliances, chefpro, grinder, tilting, tabletop, products, cookware, microwave, cutting, electric, nirlep, liters, privacy, copyright, attachment, preethi, distributors, electric, cooking |
perfectpeninsula.com - rank der domain 986090 (415611 in US)
|
|
| zum Seitenanfang ↑ |
| Silvernutmeg |
| Professional quality cookware and kitchenware |
| http://www.silvernutmeg.com |
| Provides professional kitchen equipment such as appliances, cookware, flatware and accessories. |
| Top brand professional quality cookware and kitchenware online at silvernutmeg.com |
| @home: Interiors,Bakeware,Bar Accessories,Blenders & Drink Mixers,Bread Makers,Casseroles & Dutch Ov ens,Chinese Cookware,Chopping Boards,Cleaning & Care,Coffee Machines & Accessories,Cookbooks,Cookwar e Sets,Dining Room,Electric Cooking Appliances,Food Processors & Mixers,Frying Pans,Grills & Griddle s,Hostess Trolleys & Hot Trays,Ice Cream Makers,Ice Makers,International Cuisine,Juicers,Kettles,Kit chen Tools & Utensils,Knives,Mini Bars & Fridges,Outdoor Living,Pancake Pans,Pasta Makers,Pepper & S alt Mills,Roasting Pans & Ovenware,Saucepans,Saute Pans,Stockpots & Steamers,Toasters,Wall & Ceiling Racks,Wine Racks,Workstations & Kitchen Carts |
| decoration, family, ff9900, weight, inline, display, underline, scanpan, 333300, visited, cccccc, ve rdana, productlinkdisplay, ffffff, cccccc, normal, ff0000, ffffff, background, professional, quality , header, cookware, kitchenware, sticks, steady, diamond, waring, wusthof, typhoon, gourmet, sassafr as, spices, fusion, classic, maitre, scizza, polypads, contact, facebook, peugeot, silicone, muffin, special, offers, navigation, recipes, seasonal, newsletter, guides, products |
silvernutmeg.com - rank der domain 993755 (30542 in GB)
|
|
| zum Seitenanfang ↑ |
| Kitchen Source |
| KitchenSource.com for all your kitchen needs: range hoods, kitchen |
| http://kitchensource.com |
| Offer kitchen, cabinet, bathroom and patio accessories. |
| range hoods, baker's racks, pot racks, bar stools, butcher block, under cabinet lighting, kitchen is lands, sinks, faucets,ironing boards, wine racks, counter tops, knobs, undercabinet storage, outdoor grills, cabinet hardware, outdoor firepit, bakers rack, potracks, and more by brands like enclume, sirius, imperial, broan, john boos, brabantia, rogar, catskill, whitehaus, home-styles, iron-a-way, hafele, feeny, rev-a-shelf, arctic, sojoe, sizzler, enstyle, and many more. |
| range hoods, bakers racks, kitchen islands, pot racks, bar stools, butcher blocks, kitchen carts, ir oning boards, under cabinet lighting, sinks, faucets, trash cans, counter tops, cabinet hardware, ou tdoor firepit, wine racks, outdoor grills, potracks, knobs, patio furniture, and more by brands like enclume, sirius, imperial, broan, john boos, brabantia, rogar, catskill, whitehaus, home-styles, ir on-a-way, hafele, feeny, rev-a-shelf, arctic, sojoe, sizzler, enstyle, and many more... |
| function, indexof, length, return, substring, cookie, section, 2385262442, document, location |
kitchensource.com - rank der domain 119485 (48501 in US)
|
|
| zum Seitenanfang ↑ |
| Cuda Kitchen |
| Small Kitchen Appliances, Kitchen Gadgets, Commercial Kitchen Appliances - Cuda Kitchen |
| http://cudakitchen.com |
| Featuring a variety kitchen and food service products. |
| Featuring a variety of commercial and home products, machines and accessories for concessions, resta urants, and home kitchens and home theater. |
| coffee machines, coffee makers, coffee, specialty coffee, concession equipment, restaurant equipment , home theater products, popcorn machines, snowcone machines, popcorn supplies, snow cone supplies, coffee machine parts, coffee supplies, cups, signs, tea, tea makers, cold drink machines, coolers, refrigerators, freezers, milk coolers, dinnerware, cooking equipment, espresso machines, espresso s upplies, coffee vending, espresso vending, cooking equipment, cotton candy machines, cotton candy a ccessories, commercial juice machines |
| machine, kitchen, decoration, popcorn, antique, machines, espresso, sidemenu, street, vendor, displa y, product, chocolate, document, shipping, yogurt, coffee, vending, dispensers, smoothie, kitchen, c otton, contact, returns, peanut, appliances, competitor, internet, trolly, processing, receiving, di vundersoldnoticepanel, visibility, getelementbyid, function, cudakitchen, machines, packagesunder, v isited, underline, inline, family, appliances, shopping, python, garauntee, gourmet, cheddar, season , kernel, seasoning |
cudakitchen.com - rank der domain 969400 (399265 in US)
|
|
| zum Seitenanfang ↑ |
| Not Neutral |
| notNeutral: Rios Clementi Hale Studios :: Shop Online for Casual Dinnerware, Glassware, Kids Furniture and Modern Design Products |
| http://www.notneutral.com/ |
| Offers modern ceramics, dinnerware, and accessories for the home, from the Rios Clementi Hale studio s. |
| |
| home furnishings, furniture, Select Shop, Designer's Gallery, Designer's Shop, Designer's Store, Not neutral, Neutral design, Nuetral design, Not Neutral design, Not Nuetral design |
| document, pagetracker, gajshost, notneutral, notice, unescape, 3cscript, location, fluidesign, proto col, google, gettracker, 10370058, trackpageview, script, analytics, information, javascript, reserv ed, furniture, glassware, modern, import, products, design, dinnerware, casual, clementi, studios, o nline, styles, getfullyear, rights, policy, contact, sitemap, plateslink, furniturelink |
notneutral.com - rank der domain 987337 (396173 in US)
|
|
| zum Seitenanfang ↑ |
| First Ireland |
| Firstireland Irish gifts - Waterford Crystal, John Rocha, Belleek Parian China, Denby Pottery, Galway Crystal, Lladro, Wedgwood China, Swarovski - Firstireland |
| http://www.firstireland.com/ |
| A wide selection of Irish china and crystal, including Waterford and Tyrone Crystal, Belleek china a nd Irish Linen. |
| FirstIreland Irish Gifts - Waterford Crystal, Belleek, Denby Pottery, Galway Crystal, Lladro, Wedgwo od, Swarovski, John Rocha Crystal and many more |
| Waterford Crystal, Irish Gifts, Ireland, Dublin, Belleek, Irish, collectable waterford crystal, Chin a, Denby Pottery, Irish China, Galway Crystal, Lladro, Irish Crystal, Irish China, Irish Crystal, We dgwood, Swarovski, John Rocha Crystal, Irish Linen, Royal Doulton, Collectable China, Waterford Crys tal chandeliers, Spode china, Stemware, Porcelain |
| crystal, waterford, stemware, cookware, cutlery, tableware, pottery, porcelain, figurines, lladro, s temwarewaterford, figurines, collection, swarovski, bronze, tablewaredenby, cutlerywmf, ferguson, co llectionwaterford, conran, wedgwood, stainless, villeroy, nicholas, marquis, giftware, jasper, stell ar, tablewareroyal, ireland, tyrone, tipperary, accessories, degrenne, genesis, kennedy, creuset, ch ristmas, kitchen, silver, moorcroft, collectiongenesis, cutleryvilleroy, border, parian, doulton, th omas, belleek, lighting, galway, kenwood |
firstireland.com - rank der domain 725888 (23252 in GB)
|
|
| zum Seitenanfang ↑ |
| The Paula Brown Shop |
| The Paula Brown Shop |
| http://www.paulabrownshop.com/ |
| A selection of cookware, tableware and accessories from the store in Toledo, Ohio. |
| The Paula Brown Shop Specializes in Fine Gifts and Home Furnishings |
| Paula, Brown, Shop, Alessi, Iittala, Toledo, Ohio, OH, Simon, Pearce, Glass, Gift, Firelight, Pres ent, Linens, Annieglass, Nambe, Home, Accessories, Bed, Lallie, William, Arthur, Table, Stationery, Frette, Wedding, Anniversary, Gifts, Birthday, Christmas, Toys, Crane, Invitations, Picture, Frame s, Dinnerware, Glassware, Flatware, Barware, WMF, Craft, American and ceramics. If you can handle more: Gien, Bonjour, DeRuta, Emile, Henry, Kate, Spade, Groovy, Rosenthal, Lindt |
| monroe, street, shopper, bridal, registry, toledo, personnal, contact, timeout, function, content, s plash, online, gallery, urchintracker, 5010516 |
| (SLD : paulabrownshop.com) |
|
| zum Seitenanfang ↑ |
| Chef Brad's Kitchen Store |
| Grain Education and Tips || Chef Brad's Grainology || |
| http://www.chefbrad.com/ |
| Kitchen Store features cooking classes at the store in Mesa, Arizona, and sales of cookware and acce ssories. |
| |
| |
| classes, cooking, recipes, pantry, products, nutrition, policy, recipe, calendar, online, membership , education, grainology, upcoming, gallery, gluten, kitchen, appliances, consulting, getaways, weeke nd, contact, cucina, chandler, conditions, cookbooks, specials, return, shipping, privacy, purchase, butter, hormones, fertility, unbalanced, making, articles, account, password, search, details, summ er, pricing, season, candice, favorites, newsletter, photos, videos |
chefbrad.com - rank der domain 977996 (413298 in US)
|
|
| zum Seitenanfang ↑ |
| The 18th Century Merchant |
| Fine Tableware Wedding Registry Gourmet Kitchenware Chesapeake VA | 18th Century Merchant |
| http://www.18thcenturymerchant.com |
| A family-run business offering a selection of gifts, china, home accessories, gourmet kitchenware an d stationery. |
| Fine gifts, tableware, entertaining needs, decorative accessories, wedding registry and gourmet kitc henware. |
| gifts tableware, entertaining, decorative accessories, gourmet kitchenware, Casafina, Crystal Glassw are, Dinnerware, Faiencerie de Niderviller, Flatware, Gien, Haviland Limoges, James, Juane de chrome , Lindt Stymeist, Lynn Chase, Match Pewter, Mottahedeh, Pickard, Porcel, Present Tense, Raynaud, Roy al, Worcester, Seasonal Dinnerware, Simon Pearce, Spode, Vista Alegre, Glassware by Fire & Light, Me nus, Music, Pewter, Serveware, China Accessories, Pillows,
Vases, Cookbooks, Emile Henry Couleurs, E mile Henry, Le Potier, Gourmet Food, Gourmet Gadgets, Kitchen Linens, American Wisdom Books, Desk Ac cessories, Etiquette Books, Greeting Cards, Stationery, Baby Gifts, Games, Ladies Gifts, Mens Gifts, Seasonal Virginia Gifts, Wedding Gifts, Bridal Gifts, Bridal Registry |
| merchant, century, chesapeake, virginia, copyright, tableware, choose, registered, distinctive, sele ction, location, traditional, peaches, contemporary, wedding, prissy, complimentary, timeless, class ic, design, products, retail, offering, welcome, founded, entertaining, kitchenware, discriminating, gourmet, entertaining, decorative, accessories, shopper, privacy, policy, reserved, rights, hostess ing, forest, design, visionefx, friends, stories, ongoing, grandmother, humourously, naviagte, skill fully, grooms, granddaughters, shopping |
| (SLD : 18thcenturymerchant.com) |
|
| zum Seitenanfang ↑ |
| Ashton Green |
| Ashton Green |
| http://www.ashtongreen.com/ |
| Cooking tools and dining needs available by mail order. Serves Canada and U.S.A. |
| Ashton Green is your online one-stop shop for bakeware, cooking tools, kitchen appliances, kitchen g adgets and more! Check out our variety of kitchen knives, kitchen tools, pots and pans, bundt bakewa re, saucepans and baking accessories in our catalogue or online. Ashton Green, tools that work. |
| all clad cookware, all clad pots and pans, allclad cookware, aromatherapy candles, bakeware, bakewar e online,bakeware pan, bakeware pans, bakeware shop, bakeware supplies, baking accessories, baking d ish, baking dishes, baking pan, baking pans, baking sheet, baking sheets, baking supplies, baking ti ns, blue silicone bakeware, bread bakeware, bundt bakeware, bundt pan, buy bakeware, cake bakeware, cake pans, cake tins, casserole dish, chef cook tools, chef cooking utensils, chef cooks, chef tools , chef utensils, chef's tools, chefs tools, chicagometallic bakeware, cook kitchen tools, cook tool, cook tools, cook's tools, cookie bakeware, cookie sheet, cooking cookware, cooking supplies, cookin g tool, cooking tools, cooking utensil, cooking utensils, cooks ingredients, cooks pan, cooks set, c ooks tool, cooks tools, cooks tools pressure cooker, cooks tools stainless, cooks utensils, cookware , cookware bakeware, cookware cooking utensils, cookware essentials, cookware online, cookware pan, |
| theform, document, pagetracker, waffle, shipping, default, makers, gajshost, billing, return, accoun t, change, address, searchterm, objectwidth, getelementbyid, slicersspecialty, function, ashton, men uwidth, margin, brewerstoasters, cookersfood, makerscoffee, electricstea, teakettlesgrills, griddles , makersmixers, processors, cleaningdecorstoragetoolsgardeningpetsbath, ovenswaffle, attachmentspres sure, accessoriestrivets, accessoriesflatwareknife, holders, blocksknife, sharpenersknivesslicers, b oards, cutting, toolscookbooksingredientsgraters, peelers, corers, barwarecoffee, teafondues, utensi lstable, grillbest, warmers, blenders, dishesserving, millsserving, raclettesinsulated |
ashtongreen.com - rank der domain 864094 (353921 in US)
|
|
| zum Seitenanfang ↑ |
| Great Cookware |
| Calphalon, All-Clad, Emerilware Cookware by GreatCookware.com |
| http://p4online.com/ |
| Sales of well known brands of cookware, cutlery, appliances and cooking tools. Includes recipes. |
| Cookware by P4Online save by shopping for Calphalon, All-Clad, Emerilware, Zyliss, OXO, Wusthof, cut lery, Capresso, and specials. |
| kitchen, AllClad, Calphalon, Emerilware, Capresso, Zyliss, OXO, LeCreuset, Wusthof, Endurance, Leifh eit, Pepper Mill, William Bounds, cookware, cutlery, utensils, |
| calphalon, emerilware, kitchen, cookware, william, cookware, leifheit, registry, wusthof, spring, cr euset, window, kitchen, epicurean, endurance, accessories, stainless, shipping, recipes, shopping, s ervice, excellent, cutlery, zyliss, products, cutting, customer, capresso, document, pepper, bakewar e, imports, supply, bounds, switzerland, design, cutlery, product, electrics, privacy, rating, shipp ing, shopping, specials, toolszyliss, calphaloncooking, mistobakewarecalphalon, silpat, fiberlux, kn ives, surfacescutlerywusthof |
| (SLD : p4online.com) |
|
| zum Seitenanfang ↑ |
| The Butler Pantry |
| Cuisinart Coffee Maker : All Clad Cookware : Cuisinart Food Processors : Henckels Knife : TheButlerPantry.com |
| http://thebutlerpantry.com |
| Carries a large selection of cookware, cutlery, food items, and kitchen gadgets. |
| We carry a wide variety of specialty food items, fine wines, cookware and other accessories, and we always strive to give you the best available prices. Our services include All Clad Cookware, Cuisina rt Coffee Maker, Cuisinart Food Processors, Henckels Knife and Cuisinart Cookware! |
| All Clad Cookware, Cuisinart Coffee Maker, Cuisinart Food Processors, Henckels Knife, Cuisinart Cook ware |
| pantry, butler, cuisinart, document, location, michigan, events, henckels, function, cookware, month year, products, kitchen, window, fantastic, interested, saugatuck, gourmet, historic, visiting, resi zable, height, scrollbars, menubar, statusbar, toolbar, animatedcollapse, entertaining, looking, pas sion, online, online, favorite, product, culinary, things, information, pagetracker, gajshost, every thing, course, cooking, processor, coffee, cookware, people, features, southwestern, accessories, th eurl, selection |
| (SLD : thebutlerpantry.com) |
|
| zum Seitenanfang ↑ |
| Oven Grill Plus |
| Oven Grill Plus |
| http://www.miraclegrillinc.com/ |
| Featuring counter appliances, gadgets, barbecue tools, bakeware, and bar items. |
| Oven Grill Plus website consist of several catalogs. In each catalog consumers will find great produ cts to choose from, and we are always adding new products to enrich your shopping experience. Miracl egrillinc.com: Your Online Store for great gifts and products! |
| |
| paypal, search, peeler, factor, serrated, peeler, vegetable, stainless, swivel, vegetable, serrated, double, grills, customers, miraclegrillinc, extension, account, without, verified, submit, grater, barbecue, bristle, basting, griddles, sterilized, brushes, barbecue, bleached |
| (SLD : miraclegrillinc.com) |
|
| zum Seitenanfang ↑ |
| Do Right Services |
| Bayou Classic Depot Outdoor Cooking Equipment |
| http://bayouclassicdepot.com |
| Offering gas burners, deep fat fryers, stainless steel cookware, and Cajun cooking items. |
| Bayou Classic Depot is THE Bayou Classic site since 1997. Bayou Classic Depot features all Bayou Cl assic restaurant quaility products such as stock pots, propane burners and more. |
| bayou classic, bayou classic cookware, bayou classic outdoor, bayou classic fryer, bayou classic tur key, bayou classic burner, bayou classic grill |
| classic, document, propane, cookware, highest, script, quality, consists, equipment, industry, cooki ng, official, retail, outlet, outdoor, stainless, aluminum, burners, always, thickest, restaurant, p arentnode, createelement, function, javascript, trackpageview, cooking, outdoor, equipment, setaccou nt, 17105216, location, insertbefore, getelementsbytagname, welcome, protocol, analytics, google |
bayouclassicdepot.com - rank der domain 938156 (386121 in US)
|
|
| zum Seitenanfang ↑ |
| Utilities |
| UTILITIES - Kitchen, Bath, Home, koziol, thomas paul, unique shower curtains, melamine |
| http://www.utilitieshome.com/ |
| Modern and useful items for the home, with an emphasis on kitchen products and entertaining. |
| Visit us for Koziol, Thomas paul, thomaspaul, fish shower curtain, melamine wares, jonathan adler, f un shower curtains, unique shower curtains, shower curtain fish, chilewich placemat, chilewich place mats, colorful colandars, schott zwiesel crystal, dinner plate sets, soho spice, silicone baking pan s, schott wine glasses, schott zwiesel glasses, silicone cake pan, oxo uplift, adler dinnerware dinn erware, tabletop, Serveware, silicone pan, dinner plates set, fish shower, dinner plate set. |
| Koziol, Thomas paul, thomaspaul, fish shower curtain, melamine wares, jonathan adler, fun shower cur tains, unique shower curtains, shower curtain fish, chilewich placemat, chilewich placemats, colorfu l colandars, schott zwiesel crystal, dinner plate sets, soho spice, silicone baking pans, schott win e glasses, schott zwiesel glasses, silicone cake pan, oxo uplift, adler dinnerware dinnerware, table top, Serveware, silicone pan, dinner plates set, fish shower, dinner plate set |
| smpsearchlink, pagetracker, document, classname, gajshost, utilities, middot, 6800copyright, rights, reserved, commercial, shower, acrylics, rainbow, fantastic, curtains, provincetown, street, script, javascript, gettracker, initdata, trackpageview, 1090217, melamine, protocol, unescape, 3cscript, a nalytics, google, location, welcome, disabled, replace, search, bamboo, coffee, espresso, accessorie s, simple, getelementbyid, thomas, koziol, kitchen, unique, shower, contact, melamine, curtains, coo king, tabletop |
| (SLD : utilitieshome.com) |
|
| zum Seitenanfang ↑ |
| Atar |
| ATAR |
| http://www.atar.pl |
| Offers a range of art glass, tableware, cutlery, crystal glass, lead glass, and pots. |
| |
| |
| |
| (SLD : atar.pl) |
|
| zum Seitenanfang ↑ |
| Always Porcelain |
| Welcome to Always Porcelain. Specialists in Royal Worcester, Royal Doulton, Spode, Portmeirion,Churchill China, Arora Design Products and Bilston & Battersea Enamels and Caithness and Dartington Glass. We have a large online selection of Porcelain and Bone China which includes Figurines,Enamelled boxes, Exquisite Giftware, Designer Jewellery,Tableware by Jamie Oliver, mugs, Art Wall plaques by Alan Clarke, Cath Kidston designs, Lead Crystal wine glasses and tumblers, vases, and some of the finest giftware. Our site is continually being updated. |
| http://www.alwaysporcelain.com/ |
| Offering porcelain, fine bone china and glassware from Royal Worcester, Royal Doulton, Spode and Cry stal Impressions. |
| Welcome to Always Porcelain. Specialists in Royal Worcester, Royal Doulton, Spode, Portmeirion,Churc hill China, Arora Design Products and Bilston & Battersea Enamels and Caithness and Dartington Glass . We have a large online selection of Porcelain and Bone China which includes Figurines,Enamelled bo xes, Exquisite Giftware, Designer Jewellery,Tableware by Jamie Oliver, mugs, Art Wall plaques by Ala n Clarke, Cath Kidston designs, Lead Crystal wine glasses and tumblers, vases, and some of the fine st giftware. Our site is continually being updated |
| |
| dartington, collection, crystal, worcester, portmeirion, tableware, churchill, oliver, doulton, desi gn, silver, porcelain, bilston, battersea, caithness, cherry, enamels, botanic, conran, animals, gar den, giftware, laurence, glazed, kidston, figurines, jewellery, always, critters, edition, caterpill ar, hungry, snowman, welcome, products, christmas, llewelyn, dinnerware, little, paperweights, beatr ix, potter, clarke, children, domestic, recline, limited, cheeky, queens, wonderland, strawberry |
| (SLD : alwaysporcelain.com) |
|
| zum Seitenanfang ↑ |
| Williams-Sonoma |
| Cookware, Cooking Utensils, Kitchen Decor & Gourmet Foods | Williams-Sonoma |
| http://www.williams-sonoma.com/ |
| Store for cooks. Online shopping, interactive gift registry, and gift ideas. |
| Make Williams-Sonoma your source for gourmet foods and professional-quality cookware. Choose small k itchen appliances, cooking utensils and decor that match your cooking and entertaining style. |
| cookware, kitchen utensils, kitchen decor, gourmet foods, cooking utensils, williams sonoma, small k itchen appliances, kitchen cookware |
| knives, cookware, category, electrics, glassware, outdoor, williams, sonoma, registry, sonoma, willi ams, kitchen, bakeware, cooking, tabletop, global, makers, barware, cutlery, accessories, furnishing s, baking, storage, catalog, function, offsiterequests, homekeeping, specialty, dtmtag, seafood, tea kettles, measuring, monogrammed, bedding, mixing, grills, boards, recipes, packaging, business, wedd ing, cookie, cutting, pastry, search, typeof, metricswrapper, tableware, dining, stools, javascript |
williams-sonoma.com - rank der domain 5880 (2153 in US)
|
|
| zum Seitenanfang ↑ |
| That's My Pan |
| Personalized Cake Pans and More from That's My Pan! |
| http://www.thatsmypan.com/ |
| Cake pans with lids and cutting boards for personal use, as gifts, or as fund raisers for groups and organizations. |
| That's My Pan! is pleased to offer personalized cake pans, personalized recipe boxes, personalized c utting boards, personalized photo frames and more. |
| |
| personalized, cutting, boards, frames, personalized, products, products, satisfaction, ability, craf tsmanship, artistic, expertise, company, family, combined, largest, engraving, volume, precision, co atings, custom, decorative, manufacturing, closer, paramount, always, remember, guarantee, yourself, invite, seller, something, manufacturer, license, doughmakers, standard, product, coffee, stoneware , recipe, cutlery, categories, kanteen, utensils, hardwood, tempered, bottles, bakeware, designs, se veral, trophies |
thatsmypan.com - rank der domain 977232 (408950 in US)
|
|
| zum Seitenanfang ↑ |
| Culinarydirect.com |
| Culinary Direct - Chef's Tools for the Professional or Pro at Home, Culinary equipment for the professional chef and the pro at home. |
| http://culinarydirect.com/ |
| Offers kitchen appliances and gadgets for the home cook and the professional chef. |
| A wide selection of culinary equipment for the professional chef and the pro at home. |
| bakery equipment, baking tools, bar supplies, catering equipment, chef equipment, commercial cooking equipment, cooking, cooking equipment, cooking grill, cooking supplies, cooking tools, cooking uten sils, cookware, culinary supplies, cutlery, equipment cooking, food equipment, gourmet, grills, kitc hen equipment, kitchen gear, kitchen supplies, knives, Paderno, restaurant equipment, resturant equi pment, world cuisine |
| culinarydirect, recipes, professional, cookware, pagetracker, products, culinary, products, celebrit y, featuring, website, gajshost, online, including, service, competitive, english, michael, numerous , stainless, quality, street, prepare, cooking, conditions, bakeware, direct, articles, recipes, doc ument, utensils, contact, professional, online, dispirito, utensils, baking, appeared, supplies, rem ember, center, shopping, kitchen, celebrity, productions, restaurants, serves, providers, hotels, ca sinos, lowest |
| (SLD : culinarydirect.com) |
|
| zum Seitenanfang ↑ |
|
