| Mayo County Council |
|
| http://www.mayococo.ie/ |
| Information about the county and its administration with information about services, planning and pu blications. Includes employment opportunities. |
| |
| |
| |
mayococo.ie - rank der domain 987581 (1841 in IE)
|
|
| zum Seitenanfang ↑ |
| Mayo Live |
|
| http://www.mayolive.com |
| Local guide and community directory of businesses. |
| |
| |
| |
| (SLD : mayolive.com) |
|
| zum Seitenanfang ↑ |
| Mayo on the Move |
| Mayo on the Move - Home Page |
| http://www.mayo-ireland.ie/MotM.htm |
| A wide-ranging directory and reference source for the county. |
| 'Mayo on the Move' for tourism, business, properties and more for County Mayo in the West of Ireland . |
| mayo ireland irish county mayo tourism mayo business properties MAYO IRELAND IRISH COUNTY MAYO TOURI SM MAYO BUSINESS PROPERTIES |
| ireland, island, galway, county, claremorris, connemara, pontoon, western, business, geesala, foxfor d, clogher, drummin, hollymount, charlestown, irishtown, doohoma, brackloon, crossmolina, enniscrone , bohola, ballyglass, ballyhaunis, ballyheane, ballina, ballycroy, ballycastle, ballindine, ballinro be, ballintubber, ballyvary, belmullet, bonniconlon, carnacon, carracastle, belderrig, islandeady, b angor, belcarra, castlebar, moygownagh, connaught, telegraph, westport, tuarmhic, eadaigh, turlough, people, schools, hotels, looking |
mayo-ireland.ie - rank der domain 262814 (417 in IE)
|
|
| zum Seitenanfang ↑ |
| Regional/Europe/Ireland/Mayo |
|
|
| Regional/Europe/Ireland/Mayo |
| zum Seitenanfang ↑ |
| Mayo Guide from Mayo County Council |
| |
| http://www.mayo.ie |
| Official local government site lists resources for the county's visitor attractions, events, transpo rt and accommodation. |
| |
| |
| external, tourist, county, information, beaches, government, council, website, including, ireland, i slands, castlebar, accommodation, historic, community, famous, westport, villages, people, portal, i relandwest, groups, getting, things, museums, ballintubber, national, churches, interest, continuous ly, pictured, turlough, outside, country, museum, museums, oldest, woolen, stretches, coastline, win ding, around, belmullet, achill, island, killala, fields, southwest, peninsula, earliest, population |
mayo.ie - rank der domain 977835 (1799 in IE)
|
|
| zum Seitenanfang ↑ |
| Mayo Energy Agency Official Website |
| Mayo Energy Agency-Home |
| http://www.mayoenergy.ie |
| Body promoting energy efficiency, energy conservation and renewable energy within the county. Includ es details of services, location, energy news, energy saving tips and children's educational games. |
| |
| |
| energy, agency, energy, council, renewable, trikala, latest, greece, centre, partners, county, webma ster, grants, ballina, premises, saving, agencycontact, program, september, awareness, funded, promo te, established, efficiency, conservation, region, within, renewable, statement, surveyprivacy, usco ntact, homeabout, usnews, eventspublicationsenergy, servicesfaqsagencieskidslinksenergy, tipsour, em issions, european, commission, dioxide, carbon, ireland, agencies, working, reduce, therefore, consu mption |
| (SLD : mayoenergy.ie) |
|
| zum Seitenanfang ↑ |
|
