| The British Club |
|
| http://www.britishclub.org.sg/ |
| Information on events, activities, and member resources. |
| |
| |
| |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| American Association of Singapore |
|
| http://aasingapore.com/ |
| Online resources, information, and links for American nationals living in Singapore |
| |
| |
| |
aasingapore.com - rank der domain 876694 (324855 in US)
|
|
| zum Seitenanfang ↑ |
| Italian Cultural Institute |
| Italian Cultural Institute |
| http://www.iic.org.sg/ |
| Contains useful links to both local and overseas Italian organisations and even has a list of Italia n cultural events. |
| |
| |
| italian, language, cultural, institute, iicsingapore, library, esteri, registration, evershine, serv ices, events, schedule, copyright, complex, century, corporate, affairs, foreign, promotion, culture , ministry, agency, istituto, italiano, cultura, website, tutiton, private, accredited, certificatio n, scolarships, levels, courses |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| Regional/Asia/Singapore/Society_and_Culture/Expatriate_Life |
|
|
| Regional/Asia/Singapore/Society_and_Culture/Expatriate_Life |
| zum Seitenanfang ↑ |
| Canadian Association of Singapore |
| redirect to Canadian Association of Singapore web site |
| http://web.singnet.com.sg/~cdnasg/ |
| Online bulletin for Canadian expatriates in Singapore; contains updates of events and activities, ne ws, and other links |
| |
| |
| singapore, association, canadian, please, proceed, location, redirect, replace, canadians |
| (SLD : com.sg) |
|
| zum Seitenanfang ↑ |
| Asia Homes |
| 20070102ASingapore properties, rental agents, apartment, condo, real
estate, bungalows, houses, condos, rental properties, Singapore rental houses,
condos, apartments, property, properties, broker, realtor, agency, Asia USA
Realty (Singapore) asiahomes.co |
| http://www.asiahomes.com/ |
| Real estate agent aimed at expatriates, listing accommodation for rent(short/long term) and sale. A small section with tips like the subway map. |
| 20070102BSingapore real estate, apartments, condos, houses, expat hunting properties,
property, real estate, for expats relocating to Singapore by Asia USA Realty (Singapore) asiahomes.com |
| 20070102CSingapore real estate agents, properties, bungalow, rental, condos, expatriate relocation, property,
apartment, houses, bungalow, serviced apartments, house rent, sale home,
listings, class ifieds, classified ads, Asiahomes Internet |
| singapore, properties, condos, apartments, rental, apartment, rentals, houses, bungalows, estate, he lvetica, expats, trebuchet, serviced, broker, realtor, property, agents, 20070102asingapore, agency, asiahomes, realty, family |
asiahomes.com - rank der domain 998674 (415727 in US)
|
|
| zum Seitenanfang ↑ |
| Kowloon Club |
| Kowloon Club 九龍會 |
| http://www.kowloonclub.org.sg |
| An association of Hong Kong emigrants to Singapore, providing links to useful sites. Dual-language s ite in English and Chinese. |
| |
| |
| kowloon, singapore, acrobat, member, reader, macromedia, democratic, wonderful, activities, organize d, gallery, welcome, socialize, subgroups, contact, copyright, activities, celebrated, soccer, privi leges, visits, malaysia, outings, adventures, outings, football, played, countries, society, celebra tion, brings, meanings, together, integrate, integrating, socializing, contributing, welcomes, peopl e, chinese, newsletter, getflashplayer, pluginspage, swflash, shockwave, runcontent, codebase, downl oad, version, header, quality |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| Irish Graduates Association of Singapore |
|
| http://members.tripod.com/irishgraduates/index.html |
| Association for Irish nationals and Asian graduates from Irish universities; contains updates of eve nts, news items, membership information, and links |
| |
| |
| |
tripod.com - rank der domain 857 (45 in JP)
|
|
| zum Seitenanfang ↑ |
| American Women's Association |
| American Women's Association Singapore |
| http://www.awasingapore.org/ |
| Based at the American Club, this association's site provides resources for moving to Singapore, upda tes, list of events and activities, and membership information. |
| American International Women's Association Group in Singapore |
| American Women's Association, Singapore, International Women's Group, Organization |
| american, association, singapore, founded, celebrating, anniversary |
| (SLD : awasingapore.org) |
|
| zum Seitenanfang ↑ |
| Regional/Asia/Singapore/Society_and_Culture/Expatriate_Life |
|
|
| Regional/Asia/Singapore/Society_and_Culture/Expatriate_Life |
| zum Seitenanfang ↑ |
| Asiaxpat.com |
|
| http://www.asiaxpat.com.sg |
| Directory and services portal with an "Ask an Xpat" on many topics, and links to various partners in cluding property, financial and nightlife. |
| |
| |
| |
| (SLD : com.sg) |
|
| zum Seitenanfang ↑ |
| Hollandse Club |
|
| http://www.hollandseclub.org.sg/ |
| Also known as the Dutch Club; international organization offers details on membership, events, banqu et services, and location. |
| |
| |
| |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| Australian and New Zealand Association (ANZA) |
|
| http://www.anza.org.sg |
| A voluntary organization with an Australian / New Zealand focus that provides a variety of activitie s that enhance members time in Singapore. |
| |
| |
| |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| American Club Singapore |
|
| http://www.amclub.org.sg/ |
| Town club in the heart of Singapore, listing their facilities, events, and membership criteria. |
| |
| |
| |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| Singapore Expats |
|
| http://www.singaporeexpats.com/ |
| Singapore guide on expat relocation, living and housing, with property classified search. |
| |
| |
| |
singaporeexpats.com - rank der domain 23109 (59 in SG)
|
|
| zum Seitenanfang ↑ |
| Association of Dutch Businessmen |
| Association of Dutch Businessmen |
| http://www.adb.org.sg/ |
| Information for and about activities by Dutch businessmen in Singapore |
| |
| |
| businessmen, association |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| The Belgian Luxembourg Association of Singapore |
| Belgian and Luxembourg Association of Singapore |
| http://www.blas.org.sg/ |
| Provides information about Singapore and organises and updates on activities for Belgian and Luxembo urg nationals. |
| |
| |
| events, belgian, gazette, luxembourg, singapore, pagetracker, business, exchanges, members, children , gajshost, document, monthly, president, special, association, corner, ambassador, breaking, arrive s, september, wrong0, copyright, webmaster, ambassador, upcoming, contact, hesitate, interested, bec ome, something, photographer, member, community, javascript, script, trackpageview, 6086241, gettrac ker, analytics, protocol, location, google, 3cscript, unescape, services, stimulate, recreational, e vents, regular, activities |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| XpatXperience |
|
| http://www.xpatxperience.com |
| Provides information to those wanting to move to Singapore and those already there with information on events and activities. |
| |
| |
| |
xpatxperience.com - rank der domain 951970 (2304 in SG)
|
|
| zum Seitenanfang ↑ |
| Omkring Kirken - Sømandskirken i Singapore |
|
| http://www.dkchurch.com/ |
| The Danish Seaman's Church organises activities for both Danish seafarers and expatriates in Singapo re. Site is largely in Danish with an English section. |
| |
| |
| |
| (SLD : dkchurch.com) |
|
| zum Seitenanfang ↑ |
| enterSingapore |
| Living in Singapore Expat Guide - Singapore Apartment Rentals, Job Search for Expatriates |
| http://www.entersingapore.info/ |
| Guide to moving, working and living in Singapore with information from applying for a bank account t o the pets water supply. |
| Expat guide on living and working in Singapore includes rental guide and apartment search, expat car eer and employment contract guide, expats jobs database Singapore. |
| singapore, Singapore, singapur, expat singapore, expatriate singapore, rentals singapore, apartment s singapore, moving to singapore, immigration singapore, relocation singapore, insurance singapore, jobs singapore, health, international schools, working in singapore,shopping singapore |
| singapore, expats, apartment, property, singapore, apartments, search, insurance, search, shopping, support, rental, services, travel, account, document, apartments, knight, information, living, publi c, taxation, emergency, career, importing, relocation, career, relocation, pagetracker, bedrooms, in vestor, tourism, apartment, living, properties, expatriate, health, search, internet, transport, loc ations, expatriate, serviced, expatriates, provides, sports, houses, advanced, option, rental, marin a |
entersingapore.info - rank der domain 404149 (1179 in SG)
|
|
| zum Seitenanfang ↑ |
| Singapore St. Andrew's Society |
| St. Andrews' Society |
| http://www.standrewssociety.org.sg/ |
| The Singapore St. Andrew's Society is for those of Scots birth or descent, and those just interested in Scotland and things Scottish. |
| |
| |
| society, andrew, rights, reserved, wallpapers, upcoming, andrews, events, activities, committee |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| Allo' Expat - Singapore expatriates information and resources |
| Singapore Expat – Singapore Expatriate by Allo' Expat Singapore |
| http://www.singapore.alloexpat.com |
| Provides useful information for the expatriate community in Singapore. |
| Singapore Expatriate Guide, community useful Resources. Discussion Forums for Expatriates living in or moving to Singapore. Allo’ Expat Singapore, connecting expats in Singapore. |
| Singapore,Downtown Core,Central Singapore,Ang Mo Kio New Town,Queenstown,Yishun New Town,Tuas,Bukit Timah,Bedok,Changi,Jurong Island,Sentosa,Pulau Ubin,Pulau Tekong,Bishan,Tanjong Pagar,Jalan Besar,Ka mpong Glam,Tampines,Hougang,Pasir Ris-Punggol,Jurong,Expat,Expats,Expatriate,Expatriates,Expatriatio n,expatrie,expatries,expatriados,expatriat,ekspatriaatti,ex-patriot living in,moving to,immigrate,im migrating,immigrants,immigrant,migrate,migrating,foreign,foreigner,foreigners,westerners,newcomer,ne wcomers,tourist,tourists,traveler,travelers,resident,residents,residence,residing,residency,domestic helper,maids,worker,overseas,international,permanent,citizen,citizens,citizenship,students,student, alien,au pair,visitors,professionals,associations,Republic of Singapore,Singaporean,Singapore dollar ,SGD,Immigration,Tips,Working Permit,Real Estate,Classifieds,Classified,Job,Jobs,Employment,Visa,Inf o,Information,Relocation,Services,Travel,Resources,Listings,Directory,Guide,Healthcare,International Schools. |
| import, modules, singapore, jstools, alloexpat, system, singapore, aquasoft, themes, expatbest, conn ecting, expats, americasouth, search, aggregator, password, activemenu, eastnorth, tagadelic, koreas ri, kongindiaindonesiajapanlaosmalaysiamaldivesmyanmarnepalnew, thickbox, europeeuropemiddle, logint oboggan, collapsiblock, opportunity, submit, unique, business, related, recommend, subscribe, earnle arngrow, website, america, directoryadvertise, uspolicysitemapcontact, uscountriesaustraliabanglades hbeijingbhutanbruneicambodiahong, newslink, americaotherssingapore, zealandpakistanphilippinessingap oresouth, lankataiwanthailandvietnamother, regionsasiaafricaeastern, zealandpakistanphilippinesshang haisingaporesouth, lankataiwanthailandvietnamregionsafricaasia, register, google, newsletter, userna me, pacificeastern, financial |
alloexpat.com - rank der domain 35139 (90 in MY)
|
|
| zum Seitenanfang ↑ |
| The Filipino Portal in Singapore. |
| PinoySG.com - The Filipino Portal in Singapore - Home |
| http://www.pinoysg.com |
| PINOYSG your gateway to Filipino individuals, groups, organizations and businesses in Singapore. Pro vides information regarding on and for Filipino Expats in Singapore and their involvement in the int ernational community. |
| The Filipino Portal in Singapore |
| Pinoy Singapore, Filipino Singapore, Philippine Singapore, Filipino Community, PinoyIT, OFW Singapor e, Singapore OFW, Pinoy Expat, Singapore Expat, Filipino Expat, Filipino Portal, Pinoy Portal, SG Pi noy, Pinoy Portal, Pinoy Forum, Filipino Forum, Remittance, Balikbayan, Singapore Remittance, Peso S ingapore, Peso Remittance, Singapore Remittance, OFW Remittance, Philippines Breaking News, Manila S ingapore, Filipino Groups, Filipino IT Singapore, Singapore Filipino Nurses, PINOYSG, Pinoy website, Filipino Singapore website |
| document, getelementbyid, adindex, philippine, singapore, hdcontrolbutton, innerhtml, function, time dcount, tablet, pinoys, fiesta, independence, international, affordable, videos, column, controlbutt on, required, chemotherapy, filipino, password, stopcount, membership, requirement, announced, effec tive, issuance, articles, dosage, medicine, everyday, imatinib, tablets, treatments, depending, hosp ital, frac12, invited, cordially, kababayans, activities, sunday, speaker, sunday, western, street, corner, pickering, epassport, launches |
pinoysg.com - rank der domain 64808 (251 in SG)
|
|
| zum Seitenanfang ↑ |
| GOPIO |
|
| http://www.gopio.org.sg/ |
| Global Organisation of People of Indian Origin, Singapore Chapter. Promotes the well being of people of Indian origin. |
| |
| |
| |
| (SLD : org.sg) |
|
| zum Seitenanfang ↑ |
| Expat Singapore |
|
| http://www.expatsingapore.com/ |
| Online publication containing articles, resources, tips, and updates for the expatriate in Singapore |
| |
| |
| |
expatsingapore.com - rank der domain 135461 (445 in SG)
|
|
| zum Seitenanfang ↑ |
| Orient Expat - Singapore |
|
| http://www.orientexpat.com/singapore/ |
| A community providing information to aid foreigners in Singapore. |
| |
| |
| |
orientexpat.com - rank der domain 129836 (51875 in US)
|
|
| zum Seitenanfang ↑ |
| Singapore Expat Forum |
| sgexpatforum.com :: Index |
| http://www.sgexpatforum.com/ |
| A forum for expats living in or moving to Singapore. |
| |
| |
| |
| (SLD : sgexpatforum.com) |
|
| zum Seitenanfang ↑ |
| The Protea Group Singapore |
|
| http://www.proteasingapore.com/ |
| To provide a means for South African expats in Singapore to get together. |
| |
| |
| |
| (SLD : proteasingapore.com) |
|
| zum Seitenanfang ↑ |
| Expat Living Singapore Magazine |
|
| http://www.expatliving.sg |
| Monthly magazine covering mainly housing, travel and other expatriate lifestyle issues. Limited blur bs available online. Subscription. |
| |
| |
| |
expatliving.sg - rank der domain 160111 (463 in SG)
|
|
| zum Seitenanfang ↑ |
|
