| Performing Arts & Artists Worldwide (PAAW) |
| Performing Arts & Artists Worldwide |
| http://www.paaw.com/ |
| A worldwide directory of official organizations of the performing arts, film and music industry and production and their professionals thereof. |
| Performing Arts Artists directory indexing official web sites of the Performing Arts and Artists&quo t; |
| Performing Arts directory, Performing Artists directory, directory of Performing Artists, Performi ng Arts portal Performing Artists portal |
| directory, performing, prophecy, yearly, advertise, worldwide, artists, resumes, community, working, lindsey, forgot, column, resources, homeabout, religion, christ, communityadvertise, paawpaaw, onca lendar, portal, ideasrapture, readyadvertise, translate, select, reserved, storewe, recommend, holid ay, shopping, languageenglishafrikaansalbanianarabicbelarusianbulgariancatalanchinese, rights, tradi tional, croatianczechdanishdutchestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarian icelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersian polishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietna mesewelshyiddish, uscontact, chinese, copyright, simplified, actors, popular, audition, latest, anal yst, notice, casting, puzzle, newsflash, screenwriters, account, within, auditions |
paaw.com - rank der domain 923813 (0 in US)
|
| Business/Arts_and_Entertainment/Employment |
| zum Seitenanfang ↑ |
| Performing Arts and Artists Worldwide |
| Performing Arts & Artists Worldwide |
| http://www.paaw.com/ |
| A developing worldwide directory of official sites of the arts, performing arts, film, and music ind ustry, and all aspects of official production related sites. |
| Performing Arts Artists directory indexing official web sites of the Performing Arts and Artists&quo t; |
| Performing Arts directory, Performing Artists directory, directory of Performing Artists, Performi ng Arts portal Performing Artists portal |
| directory, prophecy, performing, macbeth, advertise, wsmacbeth, yearly, worldwide, artists, resumes, another, lindsey, working, shakespeare, forgot, against, resources, column, directories, remember, visiting, username, password, auditions, portal, croatianczechdanishdutchestonianfilipinofinnishfren chgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuan ianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanis hswahiliswedishthaiturkishukrainianvietnamesewelshyiddish, christ, traditional, chinese, translate, readyadvertise, select, languageenglishafrikaansalbanianarabicbelarusianbulgariancatalanchinese, sim plified, religion, oncalendar, himself, theory, written, william, original, edited, version, entity, rights, reserved, copyright, uscontact, homeabout, hecate, paawpaaw |
paaw.com - rank der domain 923813 (0 in US)
|
| Arts/Directories |
| zum Seitenanfang ↑ |
| Performing |
|
|
| Performing |
| zum Seitenanfang ↑ |
| Stowe Performing Arts |
| Welcome to Stowe Performing Arts |
| http://www.stowearts.com/ |
| Stowe Performing Arts, a nonprofit, mounts an impressive array of musical performances. |
| |
| |
| newsletter, welcome, performing |
| (SLD : stowearts.com) |
| Regional/North_America/United_States/Vermont/Localities/S/Stowe/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Riverside School of Performing Arts |
|
| http://www.rspa.org.uk/ |
| Training in theatre for Christians aged 18-25. Performing locally and nationally. |
| |
| |
| riverside, welcome, performing |
| (SLD : rspa.org.uk) |
| Regional/Europe/United_Kingdom/England/West_Midlands/Birmingham/Arts_and_Entertainment/Theatre |
| zum Seitenanfang ↑ |
| Performing |
|
|
| Performing |
| zum Seitenanfang ↑ |
| Shea's Performing Arts Center |
| Shea's Performing Arts Center |
| http://www.sheas.org/ |
| Performing arts center in historic building sells tickets online. |
| Shea's Performing Arts Center. A national historic site. Buffalo's home for touring Broadway. |
| Shea's, Shea's Performing Arts Center, Shea's Buffalo, Mighty Wurlitzer, Tiffany, Broadway, Buffalo, theatre, theater |
| script, iframe, performing, center |
sheas.org - rank der domain 974144 (418696 in US)
|
| Regional/North_America/United_States/New_York/Localities/B/Buffalo/Arts_and_Entertainment/Theatre |
| zum Seitenanfang ↑ |
| Tulsa Performing Arts Center |
| Tulsa Performing Arts Center |
| http://tulsapac.com |
| Includes description of events, calendar of events, ticket information, location, and seating charts for four different venues which are home to ten different performing arts groups. |
| |
| Wicked, Wicked in Tulsa, Tulsa Wicked Tickets, Tulsa events, Tulsa shows, Tulsa Performing Arts Cent er, Tulsa performing arts theater, Tulsa performing arts theatre, Tulsa comedy, Tulsa drama, Tulsa m usic, Tulsa concerts, Tulsa musicals, Tulsa Broadway, Tulsa arts, Tulsa entertainment, Tulsa culture , Tulsa SummerStage, Celebrity Attractions, Tulsa speakers, Tulsa plays, Tulsa Opera, Tulsa Ballet, Tulsa Symphony, Tulsa Orchestra, Theatre Tulsa, Tulsa PAC, Tulsa PAC Trust, Tulsa jazz |
| center, performing |
| (SLD : tulsapac.com) |
| Regional/North_America/United_States/Oklahoma/Localities/T/Tulsa/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| John Lyman Center for the Performing Arts |
|
| http://www.southernct.edu/aboutscsu/lymancenter/ |
| Multi-use performing arts facility that consists of two performing spaces and a lobby art gallery. I t is also home to the Department of Theatre with its costume and scenery shops. |
| |
| |
| |
southernct.edu - rank der domain 217930 (81627 in US)
|
| Reference/Education/Colleges_and_Universities/North_America/United_States/Connecticut/Connecticut_State_University_System/Southern |
| zum Seitenanfang ↑ |
| Shea's Performing Arts Center |
| Shea's Performing Arts Center |
| http://www.sheas.org/ |
| Buffalo. Performing arts center featuring off-broadway and first-run plays, musicals, concerts. Cont ains information about the theatre, current productions, educational programs, and contact details. |
| Shea's Performing Arts Center. A national historic site. Buffalo's home for touring Broadway. |
| Shea's, Shea's Performing Arts Center, Shea's Buffalo, Mighty Wurlitzer, Tiffany, Broadway, Buffalo, theatre, theater |
| script, iframe, performing, center |
sheas.org - rank der domain 974144 (418696 in US)
|
| Arts/Performing_Arts/Theatre/Troupes_and_Companies/North_America/United_States/New_York |
| zum Seitenanfang ↑ |
| Alagappa Performing Arts Academy |
| Alagappa Performing Arts Academy |
| http://www.alagappaarts.com |
| Information about Alagappa Performing Arts Academy (APAA). It offers Bharathanatyam classes leading to certificates, diplomas and Bachelor's degree. |
| |
| |
| loading, academy, performing, alagappa |
alagappaarts.com - rank der domain 980635 (421770 in US)
|
| Regional/Asia/India/Tamil_Nadu/Society_and_Culture |
| zum Seitenanfang ↑ |
| Stites Performing Arts Center |
| Stites Performing Arts Center |
| http://www.stitesdance.com |
| Performing arts studio in Portland, Oregon specializing in jazz, tap, ballet, hip hop, modern, pilat es, baton twirling, ballroom, swing, middle eastern dance, belly dance, yoga, gymnastics. |
| |
| |
| 543535, urchintracker, center, stites, performing |
| (SLD : stitesdance.com) |
| Arts/Performing_Arts/Dance/Education/Studios/United_States/Oregon |
| zum Seitenanfang ↑ |
| Riverside School of Performing Arts |
| Welcome to Riverside Performing Arts web site |
| http://www.rspa.org.uk/ |
| Birmingham, UK. Training in theatre and Bible teaching for Christians aged 18-30. Performing locally and nationally. |
| Riverside school of performing arts, is a Christian based training school, which is part of Riversid e Church in Birmingham. RSPA offers two full time courses in Performing Arts, specialising in Drama or Music Performance, and discipleship. RSPA also works extensively in the local community providing workshops, performances, assemblies, lessons and training for schools, churches, youth groups, and community groups. |
| |
| riverside, welcome, performing |
| (SLD : rspa.org.uk) |
| Society/Religion_and_Spirituality/Christianity/Arts/Performing_Arts/Theatre |
| zum Seitenanfang ↑ |
| Arts Team |
| Arts Team |
| http://www.artsteam.co.uk/ |
| UK design professionals specializing in performing arts projects, with a portfolio that includes com mercial, governmental and institutional. |
| Arts Team - architecture for the performing arts |
| performing arts, architects, design, planning, master plans, theatres, schools |
| performing, architecture, public, shortlisted, building, architect |
| (SLD : artsteam.co.uk) |
| Business/Construction_and_Maintenance/Design/Architects/Commercial/Europe/United_Kingdom |
| zum Seitenanfang ↑ |
| Omaha Performing Arts Society |
| Omaha Performing Arts |
| http://www.omahaperformingarts.org/ |
| A non-profit organization which manages the Orpheum Theater and the Holland Performing Arts Center, presenting a variety of performing arts events, outreach and educational efforts. |
| Omaha Performing Arts |
| Omaha Performing Arts |
| header1, navmenu, contentplaceholder1, calendar, calpicker, window, images, imageoverurl, imageclick edurl, performing, radcaltoday, addparam, center, education, rentalsevent, rentals, holland, orpheum , gallery, october, photocontent, saturday, transparent, classical, xmlpath, aboutus, broadway, dona te, buytickets, subscribe, friday, thursday, sunday, monday, tuesday, wednesday, contacting, interac tive, galleries, course, testing, testing, nebraska, travel, features, powered, smtwtfs, comments, r eading, 27282930123, redesigned |
omahaperformingarts.org - rank der domain 894557 (292759 in US)
|
| Regional/North_America/United_States/Nebraska/Localities/O/Omaha/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Centre East |
| Welcome to North Shore Center for the Performing Arts in Skokie |
| http://www.centreeast.org |
| A 340-seat thrust stage/convention room house located at North Shore Center for the Performing Arts. Presents world-class artists in every performing arts genre for children and adults. Contact inform ation included. |
| |
| |
| performing, skokie, center, welcome, runcontent |
centreeast.org - rank der domain 967664 (396330 in US)
|
| Regional/North_America/United_States/Illinois/Localities/S/Skokie/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Digital Librarian: Performing Arts |
| Digital Librarian: Performing Arts |
| http://www.digital-librarian.com/performing.html |
| Links to performing arts related websites. |
| |
| |
| theatre, library, university, theater, collection, performing, shakespeare, theatre, collection, onl ine, american, festival, broadway, ballet, eacute, national, congress, center, online, college, arch ive, theater, company, internet, digital, searchable, photographs, productions, interviewed, search, public, resources, database, offers, william, washington, london, awards, resources, english, perfo rming, collections, information, libraries, digital, include, provides, association, actors, intervi ews, america |
digital-librarian.com - rank der domain 352854 (141750 in US)
|
| Arts/Performing_Arts/Directories |
| zum Seitenanfang ↑ |
| School of the Performing Arts |
| School of the Performing Arts |
| http://performingarts.latech.edu/ |
| Contains the departments of music and theatre, a calendar of events, the Louisiana Tech Concert Asso ciation, and guest artists. |
| |
| |
| performing, school |
latech.edu - rank der domain 132850 (51463 in US)
|
| Reference/Education/Colleges_and_Universities/North_America/United_States/Louisiana/Louisiana_Tech_University/Departments_and_Programs/College_of_Liberal_Arts |
| zum Seitenanfang ↑ |
| Performing Arts Workshop |
| Performing Arts Workshop | Igniting Young Minds Through the Arts |
| http://performingartsworkshop.org/ |
| Nonprofit arts education organization dedicated to helping children develop critical thinking, creat ive expression and basic learning skills through the performing arts. |
| Arts education programs, news, advocacy, and resources for teachers, artists, families and administr ators. |
| arts, education, arts education, performing arts workshop, paw, san francisco, bay area, arts advoca cy, arts resources, classroom resources, performing arts, evaluation reports, program models |
| |
| (SLD : performingartsworkshop.org) |
| Regional/North_America/United_States/California/Localities/S/San_Francisco/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| VOICE National Performing Arts Competition |
| Voice National Performing Arts Competition - Home |
| http://www.voicenpac.co.uk/ |
| A UK competition where students perform musical theatre songs for prize money to fund their Performi ng Arts education, in front of a live audience. Sponsored by the London College of Music. |
| Home. Voice NPAC Junior Competition in Yeovil, England is open to applicants aged 6 to 18. |
| Voice National Performing Arts Competition,Voice-National Performing Arts Competition,Voice,NPAC,Com petition,National Performing Arts Competition,National Performing Arts,Performing Arts Competition,P erforming Arts,Arts Competition,Voice NPAC,VoiceNPAC,Voice-NPAC,v npac,vnpac,v-npac,LCM,London Colle ge of Music,VOICE National Performing Arts Competition, |
| voicenpac, competition, applications, closed, photos, appreciation, thanks, generous, sponsors, sinc ere, source, technical, studio, community, singing, wishes, convey, registered, charity, 1121466, nu mber, commission, labelled, tovnpac, monday, engine, search, select, junior, performing, national, a ccessibility, applicants, policies, contact, applicants, details, closing, competition, syllabus, se nior, sponsors, finalists, receive, aromass |
| (SLD : voicenpac.co.uk) |
| Arts/Performing_Arts/Theatre/Awards |
| zum Seitenanfang ↑ |
| Skamania Performing Arts Foundation |
| Skamania Performing Arts |
| http://www.skamaniaarts.org/ |
| Offering musicals, dinner theater, dance classes, performing arts, and comedy guest artists. |
| productions, arts, music, musicals, dinner theater, dance classes, performing arts, comedy guest art ist |
| Skamania Performing Arts education, classes, dance |
| position, absolute, normal, ffffff, decoration, family, skamania, performing, weight, object7, objec t9, object8, everyday, picasso, object6, foundation, washes, object1, object0, italic, textstyle0, t extstyle1, object4, object5, object2, object3 |
| (SLD : skamaniaarts.org) |
| Regional/North_America/United_States/Washington/Counties/Skamania |
| zum Seitenanfang ↑ |
| Brownsville Society for the Performing Arts |
| BSPA - Brownsville Society for the Performing Arts |
| http://www.brosociety.org/ |
| A non-profit, performing arts organization producing world-class concerts and student workshops. Con tains information on the organization, projects and events. |
| BSPA is a non-profit, volunteer operated organization promoting the performing arts in Brownsville, Texas. |
| Music, Brownsville, Texas, Latin Jazz, Performing Arts, South Texas Talent Commission, events, conce rts, non-profit, Capitol Theatre, Theater Restoration, Jazz, Classical, Flamenco |
| performing, society, brownsville |
| (SLD : brosociety.org) |
| Regional/North_America/United_States/Texas/Localities/B/Brownsville/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Clarice Smith Performing Arts Center |
| Clarice Smith Performing Arts Center at Maryland |
| http://claricesmithcenter.umd.edu/ |
| Performance calendar plus information on special events and tickets. Located on the campus of the Un iversity of Maryland. |
| The Clarice Smith Performing Arts Center at Maryland is a performing arts center located on the camp us of the University of Maryland |
| Clarice Smith Performing Arts Center,Maryland,University of Maryland,Arts,Performing Arts,Prince Geo rge's County,Washington DC,Maryland,Virginia,music,opera,dance,theatre,arts |
| getelementsbytagname, document, runcontent, function, changefontsize |
umd.edu - rank der domain 6109 (2289 in US)
|
| Arts/Performing_Arts/Venues |
| zum Seitenanfang ↑ |
| ArtsFund |
| Support King and Pierce County Performing Arts Community | ArtsFund |
| http://www.artsfund.org/ |
| The program established by the Corporate Council for the Arts for individuals to support the arts an d arts education directly or through workplace giving drives. |
| Donate to the ArtsFund and help the King & Pierce County performing arts community build a rich culture in the arts. Join other Seattle area businesses by financially supporting today through cha ritable giving. |
| arts support, arts donations, performing arts donation, performing arts support, arts giving, perfor ming arts giving, seattle performing arts, support seattle performing arts, support king county perf orming arts, seattle performing arts donations, support pierce county performing arts, king county p erforming arts donations, pierce county performing arts donations, artsfund, arts fund, seattle arts fund, seattle artsfund,, king county arts fund, king county artsfund, pierce county arts fund, pier ce county artsfund |
| artsfund, pierce, county, support, organizations, grants, involved, donors, region, support, addpara m, artsfund, wednesday, community, seattle, performing, celebration, opening, gregory, prints, tacom a, february, gallery, symphony, brandonk, harrison, clicking, street, credits, organization, support er, rootvirtual, individual, lichtenstein, million, attracted, numbers, featured, privacy, policy, r ozarii, gordon, hawkins, macbeth, williams, connects, voices, artsfund, consider, happening, audienc es |
| (SLD : artsfund.org) |
| Regional/North_America/United_States/Washington/Localities/S/Seattle/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Carolina Performing Arts |
| Carolina Performing Arts :: Welcome to Carolina Performing Arts |
| http://www.carolinaperformingarts.org/ |
| Performance calendar, ticket sales, campus events, directions and parking. |
| |
| |
| |
| (SLD : carolinaperformingarts.org) |
| Reference/Education/Colleges_and_Universities/North_America/United_States/North_Carolina/University_of_North_Carolina/Chapel_Hill |
| zum Seitenanfang ↑ |
| Musical America |
| Musical America - Online International Performing Arts and Music Directory - Performing Arts News Articles - Jobs in Performing Arts Industry - Artist Managers |
| http://www.musicalamerica.com/ |
| Business source for the performing arts. News, features and 30 fully searchable databases of industr y professionals in all segments of the performing arts. |
| Musical America is the web's leading business source for the performing arts. Find the latest indust ry news, careers and contacts at MusicalAmerica.com! |
| music news,news music,music directory,international performing arts,online music directory,music art ist directory,music industry contacts,performing arts center,music industry news,history of performi ng arts,latest music news,performing arts management,music business directory,jobs in performing art s,musical america,center for performing arts,performing arts music,benefits of performing arts,music business news,music industry directory,performing arts news articles,music entertainment news,artis t managers,jobs in performing arts industry,music directories, Europe, US, UK |
| document, international, blogroll, artist, companies, performing, managers, awards, artists, newslet ter, services, releases, search, classical, 990000, industry, contacts, programs, honorees, function , decoration, calendar, online, articles, musical, contests, america, groups, location, choral, neww indow, openeventwin, windowurl, windowfeatures, windowname, events, height, advanced, eventdate, can ada, guidelines, posting, padding, visited, artists, contacts, underline, posted, margin, celebrates , releases |
musicalamerica.com - rank der domain 907426 (371009 in US)
|
| Business/Arts_and_Entertainment/Music/Directories |
| zum Seitenanfang ↑ |
| Eastern Howard Performing Arts Center |
| Eastern Howard Performing Arts Society |
| http://www.ehpas.org |
| Venue for live concerts and performances. Events calendar, driving directions, frequently asked ques tions, and technical information. |
| Eastern Howard Performing Arts Society Website
2006-2007 Calendar of events
Ticket informati on |
| Eastern Howard Performing Arts Society,EHPAS,ehpas,Eastern Performing Arts Center,Greentown Indiana, Eastern High School, Greentown Performing Arts Center |
| |
| (SLD : ehpas.org) |
| Regional/North_America/United_States/Indiana/Localities/G/Greentown |
| zum Seitenanfang ↑ |
| Joan Sutherland Performing Arts Centre |
| The Joan Sutherland Performing Arts Centre |
| http://www.jspac.com.au |
| Concert hall which holds performances, functions and provides a conservatorium for music students. C alendar of events, centre directory, virtual tour and contact details. |
| The Joan Sutherland Performing Arts Centre in High Street Penrith provides a focal point for perform ing arts activity in the Western Sydney Region. |
| blue mountains, classical music, fine music, joan sutherland, performing arts, penrith, western sydn ey, jspac, the joan, dame joan sutherland, arts, q theatre, q, arts |
| document, swapimgrestore, sutherland, performing, function, centre |
| (SLD : jspac.com.au) |
| Regional/Oceania/Australia/New_South_Wales/Localities/P/Penrith/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Poway Center of the Performing Arts |
| Poway Center for the Performing Arts |
| http://www.powayarts.org/ |
| An 815-seat state-of-the-art theater which offers performances by major touring as well as lesser-kn own artists and groups. |
| |
| |
| performing, center |
| (SLD : powayarts.org) |
| Regional/North_America/United_States/California/Localities/P/Poway/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Louisiana Tech University | School of the Performing Arts |
| School of the Performing Arts |
| http://performingarts.latech.edu/ |
| Encompasses the academic areas of music and theatre. Information on departments, programs, courses, events and organizations. Ruston, Louisiana. |
| |
| |
| performing, school |
latech.edu - rank der domain 132850 (51463 in US)
|
| Arts/Performing_Arts/Education |
| zum Seitenanfang ↑ |
| Mercyhurst College Arts Center |
| Mary D'Angelo Performing Arts Center - Part of Mercyhurst College |
| http://pac.mercyhurst.edu/ |
| Includes the Mary D'Angelo Performing Arts Center, the Taylor Little Theatre, Cummings Art Gallery a nd DanceSpace. |
| The Mary D'Angelo Performing Arts Center at Mercyhurst College provides international entertainment on world-class venues. |
| Mary D'Angelo Performing Arts Center, Performing Arts Center, Mercyhurst Performing Arts Center |
| theform, mercyhurst, college, presenters, captchav2, youtube, emailaddress, conference, gallery, fun ction, return, information, directions, street, search, submit, copyright, reserved, rights, verific ation, angelo, checkwholeform41879, involved, checkemail, isempty, schedule, cummings, center, sched ule, timeout, before, rotate, jslang, official, performing, announce, official, glimpse, season, upc oming, spring |
mercyhurst.edu - rank der domain 382395 (153214 in US)
|
| Regional/North_America/United_States/Pennsylvania/Localities/E/Erie/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| The Sunshine Coast Festival of the Performing Arts |
| The Sunshine Coast Festival of the Performing Arts |
| http://www.coastfestival.com/ |
| Piano and violin competition held in Sechelt, British Columbia. Site provides participation informat ion, schedule, and selection list. |
| The Sunshine Coast Festival of the Performing Arts |
| |
| report, awards, president, update, sponsors, posted, celebrated, anniversary, during, please, suppor t, website, performing, sunshine, festival, sechelt |
| (SLD : coastfestival.com) |
| Regional/North_America/Canada/British_Columbia/Localities/S/Sechelt/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Canadian College of Performing Arts |
| Canadian College of Performing Arts (CCPA) |
| http://www.ccpacanada.com/ |
| Offers certificate programs in the performing arts. Located in British Columbia. |
| |
| |
| canadian, college, performing, eacute, egrave, skills, agrave, students, choice, society, canada, ve rsatility, performing, future, agency, acting, professionelle, performers, function, registered, des ign, career, artistes, heritage, through, programme, career, private, accredited, travail, conduite, hautes, velopper, encourag, follow, normes, thique, institutions, training, importe, multidisciplin ary, singing, singer, speech, agility, physical, successful, screen, therefore, trainingtoday, acqui res |
| (SLD : ccpacanada.com) |
| Arts/Education/Colleges_and_Departments/North_America/Canada |
| zum Seitenanfang ↑ |
| International Society for the Performing Arts |
| ISPA | International Society for the Performing Arts |
| http://www.ispa.org |
| A not-for-profit organization of over 600 members with professional involvement in the performing ar ts. Includes resources, member directory, news, and events worldwide. |
| An international society of presenters, producers, agents, artists, and advocates of the performing arts. |
| ISPA performing arts dance theater music opera theatre |
| international, director, background, templates, images, performing, padding, society, manager, franc e, module, artistic, australia, welcome, artist, maincontent, pagetracker, visited, communications, professionals, performing, champagne, member, marketing, repeat, dubrovnik, members, members, theatr e, competition, transparent, center, content, pittaluga, middot, order3, order2, gajshost, family, d ocument, order1, benjamin, taiwan, taipei, gettracker, louisa, brisbane, hertogenbosch, queensland, 3cscript, netherlands |
| (SLD : ispa.org) |
| Business/Arts_and_Entertainment/Associations |
| zum Seitenanfang ↑ |
| ISPA - International Society for the Performing Arts |
| ISPA | International Society for the Performing Arts |
| http://www.ispa.org |
| Nonprofit organization of executives and directors of concert and performance halls, festivals, perf orming companies, and artist competitions, government cultural officials, artists' managers, and oth er interested parties with a professional involvement in the performing arts. |
| An international society of presenters, producers, agents, artists, and advocates of the performing arts. |
| ISPA performing arts dance theater music opera theatre |
| international, director, background, templates, images, performing, padding, society, manager, franc e, module, artistic, australia, welcome, artist, maincontent, pagetracker, visited, communications, professionals, performing, champagne, member, marketing, repeat, dubrovnik, members, members, theatr e, competition, transparent, center, content, pittaluga, middot, order3, order2, gajshost, family, d ocument, order1, benjamin, taiwan, taipei, gettracker, louisa, brisbane, hertogenbosch, queensland, 3cscript, netherlands |
| (SLD : ispa.org) |
| Arts/Performing_Arts/Organizations |
| zum Seitenanfang ↑ |
| Ohio Performing Arts Institute |
| Dance at Ohio Performing Arts Institute |
| http://www.ohio-performing-arts.org/ |
| OPAI is a nonprofit organization offering a multitude of educational and performance opportunities f or all ages. |
| OPAI is a not-for-profit organization offering high quality dance (ballet, tap, jazz, hip-hop, wushu ) and acting education |
| |
| institute, performing |
| (SLD : ohio-performing-arts.org) |
| Regional/North_America/United_States/Ohio/Localities/S/Springfield/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Ephrata Performing Arts Center. |
| Ephrata Performing Arts Center - Home |
| http://www.ephrataplayhouseinthepark.org/ |
| Information on upcoming shows, show dates, auditions and programs. Includes history of the group and photographs. |
| |
| |
| center, performing, ephrata |
| (SLD : ephrataplayhouseinthepark.org) |
| Regional/North_America/United_States/Pennsylvania/Localities/E/Ephrata/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Foundation for Chinese Performing Arts |
| Foundation for Chinese Performing Arts 中華表演藝術基金會 |
| http://www.chineseperformingarts.net/ |
| Chinese performing arts with events calendars. |
| |
| |
| chinese, competition, inline, frames, foundation, performing, configured, currently, archives, displ ay, releases, contribution, payment, ftpupload, browser, season, support, generous, performances, se rvice, referral, musicians, instrument, purchase, theater, online, seating, walnut, painting, events , calligraphy, festival, contact, weight, support |
| (SLD : chineseperformingarts.net) |
| Society/Ethnicity/Asian/Eastern/Chinese/Cultural_Arts |
| zum Seitenanfang ↑ |
| Performing Arts Network Japan |
| Performing Arts Network Japan |
| http://www.performingarts.jp/ |
| Informing people around the world about Japanese performing arts, this site maintains an archive of performing company profiles. |
| Performing Arts Network Japan is a Japan Foundation's website dedicated to disseminating information about the stimulating and highly diverse Japanese performing arts scene. And, with an eye to the in ternational performing arts scene, each month we will alsointroduce presenters who are presently act ive on the international stage. |
| |
| topimg, bunraku, performing, artists, festival, japanese, performance, street, puppet, function, hyo uji, international, festival, interview, overview, another, largest, programs, program, backstage, t heatre, artisans, foundation, tokoyama, professionals, national, country, theater, council, artist, people, network, theater, artists, foundation, season, hashimoto, talked, trying, turmoil, provincia l, thrown, conversation, information, played, fundamentals, manages, expose, officials, government, national |
performingarts.jp - rank der domain 922336 (0 in JP)
|
| Regional/Asia/Japan/Arts_and_Entertainment/Traditional/Performing_Arts |
| zum Seitenanfang ↑ |
| Twin Cities of Minnesota Performing Arts Directory |
| T.C. PERFORMING ARTS |
| http://www2.bitstream.net/~iras/ |
| Provides links to the state's theatre and dance companies, along with dates for shows. |
| |
| |
| minnesota, particular, sponsor, specific, performance, guidelines, posted, becoming, wondering, some one, sponsor, interest, interested, company, browse, listing, contact, directory, complete, online, theatres, performing, welcome, directory, performing, cities, happening, special, through, browsing, something, favorite, companies, theater, company |
bitstream.net - rank der domain 979569 (419648 in US)
|
| Arts/Performing_Arts/Theatre/Community_Theatre/United_States/Minnesota |
| zum Seitenanfang ↑ |
| San Diego Performing Arts League |
| About Us |
| http://www.sandiegoperforms.com/ |
| Member organization comprised of county arts organizations. Calendar of theater events, ArtsTix prog ram (day of show half-price tickets), advocacy programs, and job listings. |
| San Diego Performing Arts Presents - SD Arts Tix - Your source for tickets to all the performing art s |
| San Diego Performing Arts, Arts Tix, |
| league, performing, performing, county, design, recent, constituents, things, audience, survey, comm unity, important, following, sources, strengthen, audiences, effective, programs, developmentnetwork ingadvocacy, income, management, earned, collaborative, develops, support, communicationsprofessiona l, volunteering, becoming, partner, involved, copyright, created, bluejay, website, reserved, rights , developmentstar, awardsclick, throughout, programsmember, government, relationsgroup, marketing, b enefits, employed, become, member, especially, christian, festival, tylersd |
| (SLD : sandiegoperforms.com) |
| Regional/North_America/United_States/California/Counties/San_Diego/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Centre East - A World of Entertainment |
| Welcome to North Shore Center for the Performing Arts in Skokie |
| http://www.centreeast.org |
| A presenter of world-class artists in every performing arts genre for children and adults. Contact i nformation included. Located in Chicago. |
| |
| |
| performing, skokie, center, welcome, runcontent |
centreeast.org - rank der domain 967664 (396330 in US)
|
| Arts/Visual_Arts/Performance_Art |
| zum Seitenanfang ↑ |
| The Oakville Centre For The Performing Arts |
| Welcome to the Oakville Centre for the Performing Arts |
| http://www.oc4pa.com/ |
| Provides residents with a place to learn about themselves and the world around them through dance, m usic, storytelling and theatre. |
| |
| |
| background, repeat, images, element, position, attachment, performing, centre, oakville, welcome, pa dding, margin, ffffff |
| (SLD : oc4pa.com) |
| Regional/North_America/Canada/Ontario/Localities/O/Oakville/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| The Gordon Center for Performing Arts n |
| The Gordon Center For Performing Arts - 2008-2009 Season |
| http://www.gordoncenter.com/ |
| Music, dance, theatre, comedy, and family entertainment. Baltimore, Maryland. |
| the gordon center for performing arts |
| |
| performing, center, gordon, season, holidayportrait, copyright, billie, ohiosat, ticketmaster, tribu te, daysat, guitar, international, contact, schaefersongs, robbie, tickets, 890c29, style1, weight, information, paxtonsat, evening, gordoncenter, stevesongssun, mccutcheonsat |
| (SLD : gordoncenter.com) |
| Arts/Performing_Arts/Venues |
| zum Seitenanfang ↑ |
| Portland Center for the Performing Arts |
| Portland Center for the Performing Arts - Official Website |
| http://www.pcpa.com/ |
| Event listings and information for live music and theater in 4 halls, featuring over 900 yearly even ts. |
| 'Official website for Portland Center for the Performing Arts |
| 'PCPA, Portland Center for the Performing Arts, Keller Auditorium, Arlene Schnitzer Concert Hall, Ne wmark Theatre, Dolores Winningstad Theatre, Brunish Hall, tickets, events, Broadway, opera, symphony , |
| center, performing, portland, interest, something, thanks, visiting, browsing, showing, deadliest, b rothers, presented, entertainment, hillstrand, captain, imaginable, entertainment, premier, pacific, nationally, northwest, website, official, welcomethe, recognized, performing, centers, nation, perf ormances |
pcpa.com - rank der domain 960332 (392576 in US)
|
| Regional/North_America/United_States/Oregon/Localities/P/Portland/Arts_and_Entertainment/Clubs_and_Venues |
| zum Seitenanfang ↑ |
| Pufin Trading |
| Puffin Trading.. Global solutions for under-performing assets |
| http://puffintrading.com |
| Specialises in restoring under-performing assets for large corporations and using a company's excess capacity to increase sales, and expand markets. |
| Working world-wide to solve the problems of excess inventory and other under-performing assets of mu lti-national corporations through sound Corporate Trading techniques. |
| |
| performing, assets, solutions, puffin, trading, global |
| (SLD : puffintrading.com) |
| Regional/Oceania/Australia/New_South_Wales/Localities/N/Newport/Business_and_Economy |
| zum Seitenanfang ↑ |
| Performing Arts Youth Theatre |
| Performing Arts Youth Theatre -- Home |
| http://www.PerformingArtsYouthTheatre.com/ |
| A non profit charity. Students ages 8 to 18, perform original musical productions and take classes i n improvisation, scene study and monologues. Performs in Springfield, PA. |
| This is the official website of the Performing Arts Youth Theatre in Springfield, PA! |
| children's Theatre, Springfield PA, Performing Arts Youth Theatre |
| performing, theatre, theatre, summer, celebrating, patron, school, musical, schedule, singin, groovi n, excellence, loretta, students, creating, successful, community, reader, download, history, pictur es, contact, classes, website, founded |
| (SLD : performingartsyouththeatre.com) |
| Arts/Performing_Arts/Theatre/Troupes_and_Companies/Youth/United_States |
| zum Seitenanfang ↑ |
| Lancaster Performing Arts Center |
| Lancaster Performing Arts Center |
| http://www.lpac.org/ |
| 501(c)(3) non profit organization has granted financial support for several performances including t he entire Young People's Series. |
| |
| |
| coldfusion, requires, version, player, content, window, center, required, emailaddress, performing, lancaster |
| (SLD : lpac.org) |
| Regional/North_America/United_States/California/Localities/L/Lancaster/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Lycian Centre for the Performing Arts |
| |
| http://www.lyciancentre.com/ |
| Lycian Centre for the Performing Arts is the premier performing arts complex in New York's mid-Hudso n region. |
| |
| |
| |
| (SLD : lyciancentre.com) |
| Arts/Performing_Arts/Theatre/Troupes_and_Companies/North_America/United_States/New_York |
| zum Seitenanfang ↑ |
| Kuala Lumpur Performing Arts Centre |
| The Kuala Lumpur Performing Arts Centre (KLPac) |
| http://www.klpac.com/ |
| Located in Sentul West. Venue information, events, gallery, press release, ticketing and contact det ails. |
| Yayasan Budi Penyayang Malaysia, YTL Corporation Berhad and The Actors Studio Malaysia - set out to build a common platform to develop the performing arts in Malaysia. That platform is the Kuala Lumpu r Performing Arts Centre (KLPac), or PentasSeni KL. |
| Kuala Lumpur Performing Arts Centre,KLPac,performing arts,arts,theatres,dance performances,YTL Corpo ration,The Actors Studio,Yayasan Budi Penyayang Malaysia,Sentul,Kuala Lumpur,Malaysia |
| 1263149, urchintracker, centre, lumpur, performing |
| (SLD : klpac.com) |
| Regional/Asia/Malaysia/States_and_Federal_Territories/Kuala_Lumpur/Arts_and_Entertainment/Theatre |
| zum Seitenanfang ↑ |
| Ephrata Playhouse in the Park |
| Ephrata Performing Arts Center - Home |
| http://www.ephrataplayhouseinthepark.org/ |
| Information on upcoming shows, show dates and the various programs created by the Ephrata Performing Arts Center in Pennsylvania. |
| |
| |
| center, performing, ephrata |
| (SLD : ephrataplayhouseinthepark.org) |
| Arts/Performing_Arts/Theatre/Venues/North_America/United_States |
| zum Seitenanfang ↑ |
| The Sunshine Coast Festival of the Performing Arts |
| The Sunshine Coast Festival of the Performing Arts |
| http://www.coastfestival.com/ |
| Annual event held in Sechelt, British Columbia celebrates dance as well as instrumental and choral m usic, including classical and folk styles. Site provides participation information, schedule, and se lection list. |
| The Sunshine Coast Festival of the Performing Arts |
| |
| report, awards, president, update, sponsors, posted, celebrated, anniversary, during, please, suppor t, website, performing, sunshine, festival, sechelt |
| (SLD : coastfestival.com) |
| Arts/Music/Concerts_and_Events/Festivals |
| zum Seitenanfang ↑ |
| The Swinton High School |
| The Swinton High School, a high performing specialist school |
| http://www.swintonhigh.co.uk |
| A specialist college for the performing arts. Includes news and pupil advice. Pendlebury, Salford Ci ty. |
| The Swinton High School, a high performing specialist school |
| high school, swinton, salford, high performing specialist school, performing arts, school, education |
| school, pupils, swinton, school, teachers, results, grades, reading, enjoyed, salford, english, perf orming, outstanding, before, either, performances, achieved, people, members, science, skills, event ually, experience, schools, football, college, together, physics, classes, relief, involved, tuesday , themselves, raised, successive, competition, science, including, hinder, tournament, contact, retu rn, representing, different, opportunity, something, community, specialist, expectations, surpassed, teacher |
| (SLD : swintonhigh.co.uk) |
| Regional/Europe/United_Kingdom/England/Manchester/Education/Secondary_Schools |
| zum Seitenanfang ↑ |
| Foundation for Chinese Performing Arts |
| Foundation for Chinese Performing Arts 中華表演藝術基金會 |
| http://www.chineseperformingarts.net/ |
| Nonprofit organization which furthers and enhances the understanding and appreciation of Eastern her itage through music and the performing arts. |
| |
| |
| chinese, competition, inline, frames, foundation, performing, configured, currently, archives, displ ay, releases, contribution, payment, ftpupload, browser, season, support, generous, performances, se rvice, referral, musicians, instrument, purchase, theater, online, seating, walnut, painting, events , calligraphy, festival, contact, weight, support |
| (SLD : chineseperformingarts.net) |
| Regional/North_America/United_States/Massachusetts/Localities/L/Lincoln/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Santa Fe Performing Arts |
| Santa Fe Performing Arts |
| http://www.sfperformingarts.org |
| Performing arts in Santa Fe, offering training and theatre performance, youth, teen and adult drama education. |
| Santa Fe Performing Arts - Santa Fe Performing Arts (SFPA), devoted to educational and profession al theatre in New Mexico, utilizing performing arts as a powerful tool for educating the youth in ou r community, developing a professional Adult Resident Company dedicated to innovation and excellenc e, and providing the community with a performing arts center that is affordable and fosters professi onalism. |
| Santa Fe Performing Arts, SFPA, Theater, Live Theater, Live Theater Santa Fe, Live Theater Santa Fe NM, Theater Santa Fe NM, Santa fe, Theatre, Santa Fe NM, Santa Fe New Mexico |
| slide2, actualwidth, community, performing, document, theatre, parseint, performing, slideshowgap, c opyspeed, educational, professional, mexico, armory, program, center, layers, children, affordable, excellence, providing, theatre, provides, commitment, bilingual, productions, window, organization, function, resident, qualified, outstanding, support, reporter, displays, directors, further, bilingu al, vision, demonstrate, collaborative, chosen, awarded, complex, additionally, foundation, humaniti es, community, better, contribution, diversity |
| (SLD : sfperformingarts.org) |
| Arts/Performing_Arts/Organizations |
| zum Seitenanfang ↑ |
| Civic Hall Performing Arts Center |
| Civic Hall Performing Arts Center |
| http://www.civichall.com/ |
| Presenting ballet, orchestra, opera and music performances. Information on schedule, resident perfor mance groups and tickets. Richmond, Indiana. |
| |
| |
| browser, support, frames, performing, center |
| (SLD : civichall.com) |
| Arts/Performing_Arts/Venues |
| zum Seitenanfang ↑ |
| Brooklyn Center for the Performing Arts |
| Brooklyn Center for the Performing Arts |
| http://www.brooklyncenter.com/ |
| Presenting classical music, opera, ballet, modern dance, popular artists in concert, Yiddish Theatre , Caribbean concerts, cinema and children's programming. |
| |
| |
| browser, support, frames, upgrade, please, center, brooklyn, performing |
| (SLD : brooklyncenter.com) |
| Arts/Performing_Arts/Venues |
| zum Seitenanfang ↑ |
| Denis Ignatov |
| DENIS IGNATOV presents performing dogs and house cats |
| http://www.denis-acts.com |
| Comedy house cat act and non-stop dog flash act. |
| DENIS IGNATOV presents performing dogs and house cats |
| cat, dog, circus, act, denis, ignatov, russian, russia, performing, trained, tricks, somersault, hou secats, victor, radokhov, unique, extraordinary, pets |
| performing, ignatov, presents |
| (SLD : denis-acts.com) |
| Arts/Performing_Arts/Circus/Performers/Variety_Acts |
| zum Seitenanfang ↑ |
| Association of Bharatanatyam Artistes of India |
| Welcome To ABHAI |
| http://www.abhai.org.in/directory.php |
| A large directory of dancers and performing gurus. |
| |
| |
| performing, performing, rasikas, resource, organisation, scholar, sounds, copyright, policy, privacy , reserved, rights, lights, photographs, printings, artistes, mridangam, artistes, critics, costumes , welcome, designings, others, violin, institution |
| (SLD : org.in) |
| Arts/Performing_Arts/Dance/Classical_Indian/Dancers/Directories |
| zum Seitenanfang ↑ |
| The Performing Arts School of Worcester |
| Performing Arts School of Worcester |
| http://www.pasow.org/ |
| Information on faculty and programs. |
| Performing Arts School of Worcester, Inc. is expanding and enhancing the cultural opportunities of a ll people, diverse individual and group instruction in music, dance, and theatre arts. |
| performing arts school, worcester, dancing, theatre, music, cultural opportunities, individual and g roup instructions, arts programs, academy,orchestra |
| worcester, performing, school |
| (SLD : pasow.org) |
| Regional/North_America/United_States/Massachusetts/Localities/W/Worcester/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Donna Reed Foundation |
| Donna Reed Foundation for the Performing Arts |
| http://www.donnareed.org/ |
| Supports a performing arts center, full film archive, a museum, and professional studio facilities d edicated to developing new artists. Includes information about annual festival, scholarships and mem berships. |
| |
| |
| foundation, performing, performing, commitment, education, exciting, activities, profit, scholarship s, internships, festival, workshops, membership, museum, center, memorabilia, memorialize, accomplis hments, organization, attractions, welcome, perpetuate |
| (SLD : donnareed.org) |
| Regional/North_America/United_States/Iowa/Localities/D/Denison |
| zum Seitenanfang ↑ |
| International Index to the Performing Arts |
| Information Site - International Index to Performing Arts |
| http://iipa.chadwyck.com/ |
| Subscription-based content from more than 200 international periodicals, articles and obituaries app earing in The New York Times and The Washington Post. |
| |
| |
| performing, performing, international, journals, resource, information, comprehensive, athens, conte nt, rights, reserved, information, theatre, specializes, nearly, contains, version, published, count ries, citations, addition, million, organization, remote, remote, 2010proquest, printed, proquest, a ccess, copyright, logout, navigate, coverage, titles, regularly, interface, password, unparalleled, covering, portal, enabling, enhanced, online, search, research, simultaneously, performing, navigati on, available, accessibility, contact |
chadwyck.com - rank der domain 555503 (233103 in US)
|
| Arts/Performing_Arts/Publications |
| zum Seitenanfang ↑ |
| Leicester College of Performing Arts |
| Leicester College of Performing Arts |
| http://www.lcpa.co.uk/ |
| Provides professional training in Dance, Drama, Singing, and Musical Theatre. Leicester, England. |
| |
| |
| performing, college, leicester |
| (SLD : lcpa.co.uk) |
| Arts/Performing_Arts/Education |
| zum Seitenanfang ↑ |
| Seaglass Performing Arts |
| Seaglass Performing Arts |
| http://www.seaglassperformingarts.org/ |
| Kennebunk. Non-profit performing arts group providing theater, story telling, chorale, and dance. Ti cket, season, group, and contact information. |
| Seaglass Performing Arts |
| Seaglass, Performing Arts, Chorale, Choir, Arundel, Kennebunk, Kennebunkport, Music, Concert, Perfor mance, Performer |
| seaglass, chorale, players, performing, auditioned, season, events, kennebunk, provide, southern, co ntacting, communities, theatrical, characters, variety, performers, usually, talent, please, interne t, service, design, donated, graciously, website, hosting, seaglass, voices, audience, enrichment, c ultural, quality, participate, benefit, artist, marilyn, organizations, community, mission, organiza tion, profit, performance, opportunities, professionals, skills, artistic, enhance, established, its elf, chorale, represents |
| (SLD : seaglassperformingarts.org) |
| Arts/Performing_Arts/Theatre/Community_Theatre/United_States/Maine |
| zum Seitenanfang ↑ |
| Valentines Performing Pigs |
| Valentines Performing Pigs |
| http://www.valentinesperformingpigs.com |
| Produces shows for television and corporate and civic events. |
| |
| |
| nellie, animal, planet, performing, smartest, valentine, featured, valentines, videos, letterman, pe rforming, audiences, picture, amazing, entertainment, athletic, feature, features, audience, adorabl e, channel, clever, assemblies, microsoft, porkers, meetings, sports, halftime, professional, school s, because, something, animal, promote, described, crowds, special, planets, publication, review, hi ghest, rating, possible, spectacular, newspaper, usually, spread, genius, celebrities, appeals, chub by |
| (SLD : valentinesperformingpigs.com) |
| Business/Arts_and_Entertainment/Media_Production/Resumes_and_Portfolios/Animals_and_Wranglers |
| zum Seitenanfang ↑ |
| Liz Burville Performing Arts Centre |
|
| http://www.lizburville.co.uk/ |
| For children who wish to continue performing on a more professional basis. Includes overview, produc tions and application form. |
| |
| |
| |
| (SLD : lizburville.co.uk) |
| Regional/Europe/United_Kingdom/England/Kent/Arts_and_Entertainment/Dance |
| zum Seitenanfang ↑ |
| Ruth Eckerd Hall - Center for the Performing Arts |
| Ruth Eckerd Hall - Tampa Bay's Favorite Performing Arts Center |
| http://www.rutheckerdhall.com/ |
| News and information on events, season schedule, outreach programs and membership. Clearwater, Flori da. |
| Ruth Eckerd Hall engages the community to master, experience, discover and explore quality performin g arts in Tampa Bay and Clearwater, Florida. |
| ruth eckerd hall, performing arts tampa, performing arts florida, performing arts, concert hall flor ida, live music venue tampa, live music venue florida, arts orginization florida, arts orginization tampa |
| document, pagetracker, gajshost, gettracker, 5951873, trackpageview, dynamically, script, javascript , 6002469224515, 83122dcd4c, impression, change, insights, google, performing, center, function, swa pimgrestore, favorite, eckerd, 3cscript, unescape, analytics, location, protocol |
rutheckerdhall.com - rank der domain 475508 (190443 in US)
|
| Arts/Performing_Arts/Venues |
| zum Seitenanfang ↑ |
| Performing Arts Resources |
| Performing Arts Online Resources at Education Index |
| http://www.educationindex.com/theater/ |
| Educational information and links in over 50 categories. |
| Hand picked directory of online Performing Arts resources |
| |
| information, offers, online, american, theater, performing, ballet, performing, contains, institute, university, online, theater, history, college, school, education, movies, resources, search, review s, making, articles, students, motion, review, script, report, tickets, professional, teaching, reso urce, teachers, including, includes, titanic, educational, sciences, pictures, academy, document, ga jshost, pagetracker, chance, features, channel, source, guidelines, feature, lesson, guilds |
educationindex.com - rank der domain 706022 (297710 in US)
|
| Arts/Performing_Arts/Resources |
| zum Seitenanfang ↑ |
| Ebina Performing Arts |
| Ebina Performing Arts |
| http://www.ebinaperformingarts.com/ |
| 蛯名健一の公式サイト。プロフィール、映像を含むギャラリーが中心。 |
| Ebina Performing Arts
Director, Choreographer, Dance Performer
Kenichi Ebina |
| dance performer ebina kenichi newyork |
| performing, performances, visual, illusion, choreographer, director, company, performer, fusion, ent ertainment, kenichi, multiple |
| (SLD : ebinaperformingarts.com) |
| World/Japanese/アート/パフォーミングアート/ダンス/ストリートダンス |
| zum Seitenanfang ↑ |
| Myles Reif Performing Arts Center |
|
| http://www.reifcenter.org |
| Presents three performing Artists series, an active dance school and an art gallery. Grand Rapids, M N. |
| |
| |
| |
| (SLD : reifcenter.org) |
| Regional/North_America/United_States/Minnesota/Localities/G/Grand_Rapids/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Cambridge Performing Arts Centre |
| |
| http://www.cambridgeperformingartscenter.org/ |
| Performing in the restored Strand Theatre. Current season schedule, audition dates, and ticket infor mation. |
| |
| |
| |
| (SLD : cambridgeperformingartscenter.org) |
| Regional/North_America/United_States/Ohio/Localities/C/Cambridge/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Performing Arts News |
| Connect to the Performing Arts - Performing Arts News |
| http://www.performingartsnews.com |
| Weekly news, articles, and events listings covering theatre, film, and television. Aimed at an audie nce of actors, writers, directors, and producers. |
| Performing Arts News connects you to the performing arts, theatre, film and television. News you nee d to know, read by actors, directors, writers and producers in the entertainment industry |
| performing arts news, performing arts, performing, arts, news, australian theatre, theatre, theatre news, auditions, actors, directors, theatre auditions, australian theatre, performances, film indust ry, sydney theatre, melbourne theatre |
| module, latest, production, style1, style2, theatre, articles, industry, sydney, access, theatre, li stings, morning, articles, jlanguage, performing, testimony, events, acting, script, polanski, scree n, margin, career, stained, gibson, addevent, color3, color4, color2, color1, window, function, aust ralian, actors, connect, marketing, height, classes, auditions, feature, moduleslider, everywhere, g etcoordinates, plenty, trends, inside, networking, feathers, storyother, productions |
| (SLD : performingartsnews.com) |
| Arts/Performing_Arts/Publications |
| zum Seitenanfang ↑ |
| Performing and Screen Arts |
| Film school, Performing and Screen Arts courses at Unitec, Auckland |
| http://www.unitec.ac.nz/?A9F841B4-C801-4B76-83ED-DE99EF1CA107 |
| Offers courses in performing and screen arts. |
| |
| |
| screen, performing, campus, unitec, bachelor, technology, students, certificate, diploma, contempora ry, facilities, theatre, experience, industry, student, theatre, programmes, studies, pagetracker, p ractice, applied, communication, visual, unitec, performances, document, screen, career, welcome, pe rforming, international, professionals, search, gettracker, calendar, inspired, guided, successful, unitec, courses, performance, writing, introductory, school, technician, directing, programmes, perf ormances, production, graduate, 197000 |
| (SLD : ac.nz) |
| Regional/Oceania/New_Zealand/Auckland/Councils/Auckland_City/Education/UNITEC/Faculties |
| zum Seitenanfang ↑ |
| D and D School of Performing Arts |
| D & D Performing Arts School : Home |
| http://www.dandd.net.au/ |
| Performing arts school located on the Gold Coast of Australia. Offering classes in dance, ballet, ta p, singing and acrobatics. |
| |
| |
| monday, school, saturday, thursday, performing, december, timetable, labour, birthday, closes, octob er, weekmonday, friday, rehearsal, eisteddfod, centresaturday, brisbane, bluewire, design, 2010gold, concert, public, holidays, august, september, classes, holiday, school, welcome, enrolled, students , biggest, contact, newsletter, available, february, january, enrolment, tuition, personalised, offe rs, attention, individual |
| (SLD : dandd.net.au) |
| Arts/Performing_Arts/Dance/Education/Studios/Australia |
| zum Seitenanfang ↑ |
| Bakersfield College Department of Music |
| Department of Performing Arts - Performing Arts
Events |
| http://www2.bc.cc.ca.us/music/ |
| Details about the faculty, facilities and curriculum. |
| |
| |
| performing, events, department, programs, ensembles, theatre, faculty |
| (SLD : ca.us) |
| Reference/Education/Colleges_and_Universities/North_America/United_States/California/Two-Year_Colleges/Bakersfield_College |
| zum Seitenanfang ↑ |
| Bakersfield College Department of Music |
| Department of Performing Arts - Performing Arts
Events |
| http://www2.bc.cc.ca.us/music/ |
| Details about the faculty, facilities and curriculum. |
| |
| |
| performing, events, department, programs, ensembles, theatre, faculty |
| (SLD : ca.us) |
| Regional/North_America/United_States/California/Localities/B/Bakersfield/Education/Colleges_and_Universities |
| zum Seitenanfang ↑ |
| International Association of Libraries and Museums of the Performing Arts |
| Welcome to SIBMAS |
| http://www.sibmas.org/English/sibmas.html |
| Forum for colleagues promoting research and documentation in the performing arts. |
| SIBMAS is the forum for colleagues from all over the world promoting research, practical and theoret ical, in the documentation of the performing arts |
| performing arts documentation libraries museums |
| sibmas, collections, documentation, between, performing, international, theatre, recent, development s, around, future, uniting, collections, points, connecting, exciting, current, knowledge, dispersed , connect, curators, allowing, opening, audience, global, technology, extended, centenary, russes, e xperience, materials, exhibiting, ballets, practical, promote, following, theoretical, research, per forming, libraries, association, international, welcome, museums, welcome, establish, permanent, col laboration, munich, conference, facilitate |
| (SLD : sibmas.org) |
| Reference/Museums/Museum_Resources/Organizations |
| zum Seitenanfang ↑ |
| The Wolanski Foundation |
| The Wolanski Foundation (TWF) - Home |
| http://www.twf.org.au/ |
| A foundation which facilitates management, appreciation and presentation of the performing arts. |
| The Wolanski Foundation facilitates management, appreciation and presentation of the performing arts . |
| arts management, performing arts, information management, knowledge management, libraries, museums, archives, bibliographies, Dennis Wolanski Library of the Performing Arts, Sydney Opera House, resear ch, resources, consulting, collections, twf, TWF |
| library, learning, searching, research, managing, currents, sydney, performing, contact, foundation, wolanski, information, management |
| (SLD : org.au) |
| Regional/Oceania/Australia/Arts_and_Entertainment/Performing_Arts |
| zum Seitenanfang ↑ |
| Brooklyn Center for the Performing Arts |
| Brooklyn Center for the Performing Arts |
| http://www.brooklyncenter.com/ |
| Classical music, opera, ballet, modern dance, popular artists in concert, Yiddish theater, Caribbean concerts, cinema, children's programming. Profile, events, schedule, tickets, travel directions, co ntact information. |
| |
| |
| browser, support, frames, upgrade, please, center, brooklyn, performing |
| (SLD : brooklyncenter.com) |
| Regional/North_America/United_States/New_York/Localities/N/New_York_City/Brooklyn/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Nguyen Dance Company |
| Nguyen Dance Company |
| http://www.dannydancers.com |
| Nguyen Dance Company (NDC) is a 501(c)(3) nonprofit organization. The company's signature style blen ds contemporary elements with traditional Vietnamese aesthetics. Located in Oakland, California. |
| Nguyen Dance Company and The Vietnamese Performing Arts Group |
| Nguyen Dance Company, NDC, The Vietnamese Performing Arts Group, Vietnamese Performing Arts Group, V ietnamese Performing Arts, TVPAG, VPAG, Vietnam, Vietnamese, Dance, Danny Nguyen, Dance Company, Per forming Arts, Danny Nguyen Dancers and Musicians, DNDM, dance non-profit |
| company, nguyen |
| (SLD : dannydancers.com) |
| Arts/Performing_Arts/Dance/Modern/Companies/North_America/United_States/California |
| zum Seitenanfang ↑ |
| Mandurah Performing Arts Centre |
| Mandurah Performing Arts Centre |
| http://www.manpac.com.au/ |
| Find out what's showing at the Boardwalk Theatre. |
| |
| |
| centre, performing, mandurah |
| (SLD : manpac.com.au) |
| Regional/Oceania/Australia/Western_Australia/Localities/M/Mandurah/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Performing Arts Network Japan |
| Performing Arts Network Japan |
| http://www.performingarts.jp/ |
| 日本の舞台芸術情報を海外向けに発信することを目的に国際交流基金が運営するサイト。各分野のリンク集。 |
| Performing Arts Network Japan is a Japan Foundation's website dedicated to disseminating information about the stimulating and highly diverse Japanese performing arts scene. And, with an eye to the in ternational performing arts scene, each month we will alsointroduce presenters who are presently act ive on the international stage. |
| |
| topimg, bunraku, festival, performing, artists, street, puppet, performance, japanese, hyouji, funct ion, festival, overview, interview, international, foundation, national, trying, artisans, theater, professionals, programs, largest, backstage, artist, theatre, hashimoto, council, talked, people, fo undation, another, tokoyama, program, artists, country, theater, season, network, thrown, organizing , committee, fundamentals, played, avignon, expose, manages, conversation, turmoil, tossed, informat ion |
performingarts.jp - rank der domain 922336 (0 in JP)
|
| World/Japanese/アート/パフォーミングアート/ガイドとディレクトリ |
| zum Seitenanfang ↑ |
| Mohawk Valley Ballet |
| Mohawk Valley Performing Arts, Inc. | Home Page |
| http://www.mvperformingarts.org/ |
| Mohawk Valley Ballet's dancers are serious ballet students who want to experience the thrill of perf orming in a professional atmosphere. They are chosen at a yearly open audition, and sign contracts w hich commit them to attending three technique classes per week at the studio of their choice. (Utica , NY) |
| |
| |
| performing, mohawk, valley |
| (SLD : mvperformingarts.org) |
| Arts/Performing_Arts/Dance/Ballet/Companies/North_America/United_States |
| zum Seitenanfang ↑ |
| YourCloseup.com |
| Welcome to Yourcloseup.com! Website Design for Performing Artists and Small Businesses |
| http://www.yourcloseup.com |
| Design company that caters to performing artists and artistic individuals. |
| Welcome to YourCloseup.com, the website design company that caters to performing artists, actors, si ngers, dancers and artistic individuals. |
| website design, Laura Nathanson, performing artists, performers, singers, website design for perform ing artists, individual websites |
| navbar, macromedia, yourcloseup, quality, header, height, getflashplayer, pluginspage, version, code base, download, runcontent, swflash, shockwave, design, company, design, welcome, website, courtesy, incredibly, satisfied, customers, browse, testimonials, guaranteed, satisfaction, prices, comstock, around, questions, copyright, purchase, images, rights, reserved, provided, companies, individuals, artistic, artists, clients, businesses, creative, caters, artists, performing, yourcloseup, busines ses, samples, everything |
| (SLD : yourcloseup.com) |
| Computers/Internet/Web_Design_and_Development/Designers/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Pennsylvania Performing Arts on Tour |
| Pennsylvania Performing Arts on Tour |
| http://www.pennpat.org |
| Increasing opportunities for professional performing artists in dance, music, and theater, to obtain successful touring engagements by providing resources for performers and presenters. |
| |
| |
| nakatani, pennpat, tatsuya, design, browsers, policy, privacy, internet, firefox, explorer, netscape , philadelphia, street, become, originally, artist, featured, percussionist, contemporary, resources , opportunities, performing, pennsylvania, grants, roster, artist, pennpat, toured, extensively, fac ebook, singing, cymbals, throughout, acclaim, drumset, utilizing |
| (SLD : pennpat.org) |
| Arts/Organizations/Regional/United_States/Pennsylvania |
| zum Seitenanfang ↑ |
| The Washington Center for the Performing Arts |
| The Washington Center for the Performing Arts |
| http://www.washingtoncenter.org/ |
| Information on current season, box office, theater rental, technical specifications and membership. Olympia, Washington. |
| The Washington Center for the Performing Arts, South Puget Sound's largest performing arts facility, is committed to providing a wide variety of entertainment and cultural activities for the residents of five counties. |
| Washington Center for the Performing Arts, The Washington Center, Washington Center, Olympia Perform ing Arts, Olympia Theater, Olympia Theatre, Theater Olympia, Performing Arts Washington State, 21st Century Masters, Mark Morris Dance Group, Mystical Arts of Tibet, The Claremont Trio, Songs From Mam a's Table, George Winston, Vassily Primakov, Sing-A-Long Wizard of Oz, Kiss Me, Kate, Alison Brown - A Winter's Eve, A Christmas Carol, Kate Clinton, Dianne Reeves, Seattle Symphony, David Guerrier, S tephen Schwartz and Friends, The Acadian Connection, Reno in Rebel Without a Pause, Richard Goode, N ewport Jazz Festival, The Children of Uganda, The Music Man, Julio Bocca and Ballet Argentino, Kath y Mattea, Rent |
| performing, center, washington |
| (SLD : washingtoncenter.org) |
| Arts/Performing_Arts/Venues |
| zum Seitenanfang ↑ |
| Children's Creative & Performing Arts Academy of San Diego |
| Childrens Creative and Performing Arts Academy of San Diego |
| http://www.ccpaasd.com/ |
| K-12 college-preparatory school enrolling approximately 350 students. Classes include music, dance, and art. Profile, faculty, tuition, history, philosophy, admissions, and policies. |
| |
| |
| academy, performing, childrens, creative |
| (SLD : ccpaasd.com) |
| Regional/North_America/United_States/California/Localities/S/San_Diego/Education/K-12/Private |
| zum Seitenanfang ↑ |
| Washington Center for the Performing Arts |
| The Washington Center for the Performing Arts |
| http://www.washingtoncenter.org/ |
| Performing arts facility providing a variety entertainment and cultural activities. Features announc ements, current events calendar, ticket sales, and Center Gallery highlights. |
| The Washington Center for the Performing Arts, South Puget Sound's largest performing arts facility, is committed to providing a wide variety of entertainment and cultural activities for the residents of five counties. |
| Washington Center for the Performing Arts, The Washington Center, Washington Center, Olympia Perform ing Arts, Olympia Theater, Olympia Theatre, Theater Olympia, Performing Arts Washington State, 21st Century Masters, Mark Morris Dance Group, Mystical Arts of Tibet, The Claremont Trio, Songs From Mam a's Table, George Winston, Vassily Primakov, Sing-A-Long Wizard of Oz, Kiss Me, Kate, Alison Brown - A Winter's Eve, A Christmas Carol, Kate Clinton, Dianne Reeves, Seattle Symphony, David Guerrier, S tephen Schwartz and Friends, The Acadian Connection, Reno in Rebel Without a Pause, Richard Goode, N ewport Jazz Festival, The Children of Uganda, The Music Man, Julio Bocca and Ballet Argentino, Kath y Mattea, Rent |
| performing, center, washington |
| (SLD : washingtoncenter.org) |
| Regional/North_America/United_States/Washington/Localities/O/Olympia/Arts_and_Entertainment/Theater |
| zum Seitenanfang ↑ |
| Lycian Centre for the Performing Arts |
| |
| http://www.lyciancentre.com/ |
| A performing arts complex in Sugar Loaf, in New York's mid-Hudson region. |
| |
| |
| |
| (SLD : lyciancentre.com) |
| Arts/Performing_Arts/Venues |
| zum Seitenanfang ↑ |
| College of Visual and Performing Arts |
| College of Visual and Performing Arts at JMU |
| http://cvpa.jmu.edu/ |
| View schools, performance schedule, and contact information. |
| |
| |
| performing, visual, statement, publisher, information, contact, webmaster, privacy, revised, college |
jmu.edu - rank der domain 49820 (18787 in US)
|
| Reference/Education/Colleges_and_Universities/North_America/United_States/Virginia/James_Madison_University/Departments_and_Programs/Visual_and_Performing_Arts |
| zum Seitenanfang ↑ |
| M.Ballet Performing Arts |
| |
| http://www.mbpa-sg.com/ |
| バレエ指導。クラス概要、レッスン案内、発表会の様子。 |
| |
| |
| singapore, performing, ballet |
| (SLD : mbpa-sg.com) |
| World/Japanese/地域/アジア/シンガポール/アート・娯楽 |
| zum Seitenanfang ↑ |
| Concord Carlisle Patrons Of Performing Students |
| CCHS 2009-2010 | CCPOPS - Concord Carlisle Patrons Of Performing Students |
| http://ccpops.org/ |
| Nonprofit organization which supports students involved in the performing arts, in Concord High Scho ol and Carlisle High School. |
| |
| |
| ccpops, import, modules, parents, performing, events, announce, ccpops, please, please, system, stud ents, concord, carlisle, performing, events, community, information, coordinate, important, rehearsa ls, person, welcome, webmaster, talented, technical, interest, membership, volunteer, calendar, arch ive, fundraising, theater, students, should, patrons, civicrm, involved, aggregator, falsettos, cont acts, community, resonates, configuration, assume, theatre, require, orchestra, upgraded, wonderful, little |
| (SLD : ccpops.org) |
| Regional/North_America/United_States/Massachusetts/Counties/Middlesex/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Lycian Centre for the Performing Arts |
| |
| http://www.lyciancentre.com/ |
| Performing arts complex provides season calendar, seating chart, and ticket sales. |
| |
| |
| |
| (SLD : lyciancentre.com) |
| Regional/North_America/United_States/New_York/Localities/S/Sugar_Loaf |
| zum Seitenanfang ↑ |
| 51 Walden |
|
| http://www.51walden.org/ |
| This Performing Arts Center is operated by Friends Of the Performing Arts in Concord (MA). |
| |
| |
| |
| (SLD : 51walden.org) |
| Regional/North_America/United_States/Massachusetts/Localities/C/Concord/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| The Met |
| The Metropolitan Performing Arts Center |
| http://www.mettheater.com/ |
| The Metropolitan Performing Arts Center in the Old Clemmer Theater. |
| |
| |
| return, function, hidden, visibility, position, absolute, standing, community, presenters, contact, events, facilities, season, seventh, nominated, series, competition, settimeout, coming, subcommunit y, settime, subpresenter, performing, metropolitan, center, subevents, subfacilities, gettime, windo w, status, document, innertext |
| (SLD : mettheater.com) |
| Regional/North_America/United_States/Washington/Localities/S/Spokane/Arts_and_Entertainment/Theater |
| zum Seitenanfang ↑ |
| Windy City Performing Arts |
| Windy City Performing Arts |
| http://www.windycitysings.org/ |
| Chicago's Windy City Gay Chorus, Windy City Slickers, and Aria, a small women's ensemble. |
| |
| |
| halsted, saturday, listings, summer, hoover, chicago, center, eventbrite, leppen, theatre, purchase, events, support, merchandise, ensembles, performing, contact, tickets, through, members |
| (SLD : windycitysings.org) |
| Society/Gay,_Lesbian,_and_Bisexual/Arts_and_Entertainment/Music/Bands_and_Artists/Choirs |
| zum Seitenanfang ↑ |
| Music and Performing Arts at Trinity Cathedral |
| Music and Performing Arts at Trinity Cathedral |
| http://www.mandpa.org/ |
| Dedicated to building community and enhancing the quality of life through the arts. Home of a weekly brownbag lunch concert series. |
| |
| |
| programs, concerts, brownbag, gallery, sponsors, support, performing, trinity, cathedral |
| (SLD : mandpa.org) |
| Regional/North_America/United_States/Ohio/Localities/C/Cleveland/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Wharton Center |
| Wharton Center for Performing Arts at Michigan State University |
| http://web.msu.edu/~wharton/ |
| Michigan State University's performing arts facility. Presentations, tickets and seating, directions , and center information. |
| Michigan's Premiere Perfroming Arts Center, for Broadway, Jazz, Classical, Dance and More. |
| Broadway, Dance, Jazz, Classical, Variety, World Music, Act One Family, Jazz Kats, World View, Perfo rming, Arts, Performing Arts, Performing Arts Center, Wharton, Wharton Center, Stage, Musicals, Mich igan, East Lansing, Lansing, Michigan State University, MSU |
| center, michigan, performing, wharton, redirected, university, whartoncenter, please, seconds, websi te, perfroming, premiere, please |
msu.edu - rank der domain 6253 (2325 in US)
|
| Regional/North_America/United_States/Michigan/Localities/E/East_Lansing/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| Martin-Lipscomb Performing Arts Center |
| |
| http://www.highlandsperformingartscenter.org/ |
| Local facility provides a venue for the performing arts. Includes history, events, ticket informatio n. |
| |
| |
| |
| (SLD : highlandsperformingartscenter.org) |
| Regional/North_America/United_States/North_Carolina/Localities/H/Highlands/Arts_and_Entertainment |
| zum Seitenanfang ↑ |
| RiverCenter for the Performing Arts |
| |
| http://www.riverarts.net/ |
| A new showplace for performing arts in Columbus, Georgia. |
| |
| |
| |
| (SLD : riverarts.net) |
| Regional/North_America/United_States/Georgia/Localities/C/Columbus/Arts_and_Entertainment/Venues |
| zum Seitenanfang ↑ |
| Maritime Conservatory of Performing Arts |
| Maritime Conservatory of Performing Arts |
| http://www.maritimeconservatory.com/ |
| Provides performing arts education for children and adults including music (instrumental and voice), theory, dance, musical theatre and actors' studio. Lists programs, news and contact details. |
| Maritime Conservatory of Performing Arts |
| maritime conservatory of performing arts,halifax,nova scotia,Canada,Atlantic,coast,Performing,Arts,e ducation,children,MCPA,voice,Kindermusik,ballet,jazz,character,mcpaboyle |
| conservatory, calendar, academic, performing, maritime, kindermusik, learning, halifax, schedule, cl asses, studio, school, rental, contact, classes, summer, ensembles, history, concert, kindermusik, s chool, shared, diepeveen, annelies, addition, valedictorians, recollections, credit, registration, p hotos, growing, payment, incentive, credits, living, healthy, qualify, search, rights, reserved, cop yright, medium, address, telephone, chebucto, programs, edition, including, scholarships, bursaries, information |
| (SLD : maritimeconservatory.com) |
| Regional/North_America/Canada/Nova_Scotia/Localities/H/Halifax/Education |
| zum Seitenanfang ↑ |
| Performing Arts Center |
| Texas Performing Arts |
| http://www.utpac.org/ |
| Overview of the current season, audience services, box office, map and contact information. |
| |
| |
| events, performing, theatre, seating, parking, student, special, quartet, concert, school, informati on, performance, daniel, information, tickets, university, request, austin, community, document, col laborative, collaboration, through, performing, string, academic, development, ensemble, scholarship s, academic, flickr, melissa, tickets, presales, promotions, upcoming, butler, department, season, c ollaborative, volunteer, scholarship, performances, contact, universe, within, michael, pollan, cole man, ornette, second |
| (SLD : utpac.org) |
| Reference/Education/Colleges_and_Universities/North_America/United_States/Texas/University_of_Texas/Austin |
| zum Seitenanfang ↑ |
|
Sitemap.XML / Sitemap.HTML / search / Kontakt & Impressum / Domains
