| Graduate School of Master Coaches |
| 4 Day Certified Master Coach Course -Business, Executive Coaching |
| http://www.aaa-coaching-partners.com |
| Program for starting your own personal coaching business. |
| Leadership coaching and executive coaching coach training by Dr Skiffington's expert team. |
| global leadership, business coaching, coach, coaching, culture, leadership skill, leadership, corpor ate coaching, executive coaching, coaching course, executive, behavioral coaching. |
| education, graduate, school, master, consistently, leading, institute, countries, training, internat ional, annual, report, centre, institution, graduates, course, behavioral, business, executive, coac hing, provider, sciences, california, coaches, international, certified, registered |
| (SLD : aaa-coaching-partners.com) |
|
| zum Seitenanfang ↑ |
| Fill Your Practice |
| Fill Your Coaching Practice, Coach and Mentor Professional Practice Marketing |
| http://www.fillyourpractice.com |
| Ebook with marketing strategy for coaches. |
| Introducing the most authentic and effective way to fill your coaching practice... FAST! |
| coach, coaching, mentor, mentoring, marketing, coach training, certification, life, success, compass , professional practice, alliance, Will Craig, ebooks |
| clients, practice, coaching, practice, marketing, coaching, system, course, coaches, receive, busine ss, designed, success, friend, program, marketing, getting, information, important, months, through, making, training, little, filling, building, skills, results, success, without, clients, worked, al liance, methods, professional, decision, michael, techniques, income, discount, effective, attractin g, himself, minutes, access, become, quickly, coming, comprehensive, selling, developed |
| (SLD : fillyourpractice.com) |
|
| zum Seitenanfang ↑ |
| International Coach Federation |
|
| http://www.coachfederation.org |
| ICF is non-profit, professional organization that represents personal and business coaches. Its miss ion is to build, support and preserve the integrity of the coaching profession. Lexington, KY. |
| |
| |
| |
coachfederation.org - rank der domain 98427 (37470 in US)
|
|
| zum Seitenanfang ↑ |
| Health/Alternative/Coaching/Professional_Resources |
|
|
| Health/Alternative/Coaching/Professional_Resources |
| zum Seitenanfang ↑ |
| International Coach Academy |
| icoachacademy.com | A coaching community |
| http://www.icoachacademy.com/ |
| A global training program using a unique combination of teleclass training, and a powerful online tr aining environment. Melbourne, Australia. |
| International Coach Academy is an ICF accredited coach training school offering coaching programs to become a certified life coach, executive coach, career coach, spiritual coach or business coach. Ch ange the world through coaching. |
| |
| coaching, coaching, function, international, swapvalues, bowery, select, bronwyn, certified, profess ional, starting, curiosity, create, information, kookaburra, coaches, questions, morning, laughing, successful, clients, program, submitted, contact, search, republic, ireland, academy, appear, territ orypanamapapua, federationrwandasaint, kangaroos, arabiasenegalserbiaseychellessierra, leonesingapor eslovakiasloveniasolomon, marinosaudi, helenasamoasan, ricoqatarreunionromaniarussian, outside, guin eaparaguayperuphilippinespitcairnpolandportugalpuerto, islandnorwayomanpakistanpalaupalestinian, ofk uwaitkyrgyzstanlaolatvialebanonlesotholiberialibyaliechtensteinlithuanialuxembourgmacaomacedoniamada gascarmalawimalaysiamaldivesmalimaltamartiniquemauritaniamauritiusmayottemexicomoldova, northkorea, manisraelitalyjamaicajapanjerseyjordankazakhstankenyakiribatikorea, bissauguyanahaitihondurashong, k onghungaryicelandindiaindonesiairaniraqisle, ofmonacomongoliamontenegromontserratmoroccomozambiquemy anmarnamibianaurunepalnetherlandsnew, caledonianew, feasting, window, gra |
icoachacademy.com - rank der domain 286068 (110771 in US)
|
|
| zum Seitenanfang ↑ |
| Coach Training Alliance |
| Life Coach Training - Life Coaching Certification |
| http://www.coachtrainingalliance.com/ |
| Delivers coaching and mentoring programs for life coaching, personal coaching, executive and busines s coaching. |
| Life Coaching Certification in just 6 months. Graduate with paying clients guaranteed. Take our free life coach quiz and see if you have what it takes to be a great coach. |
| Life Coach Training, Life Coaching Certification |
| coaching, becoming, training, career, mentor, executive, leadership, business, relationship, spiritu al, success, certified, program, accelerator, programs, personal, education, corporate, urchintracke r, 176105, certification, opportunities, expect, specialties |
coachtrainingalliance.com - rank der domain 337979 (136813 in US)
|
|
| zum Seitenanfang ↑ |
| Soulwork |
| ☼ Help for Emotional Blocks & Relationship Problems ☼ |
| http://www.soulwork.net |
| Resources and articles for coaches and trainers in using effective soul-based coaching for a wide va riety of mental, emotional, physical and relationship challenges. Specializes in relationship coachi ng and have offices in Canada and Europe. |
| Pull Yourself Together & Live with Passion |
| soulwork,systemic,coaching,solutions,relationship coaching, telephone,
soulworks,health,management,c onfidence,self esteem, psychotherapy,brief,family systems,coach training
psychology,relationships,ma nagers,sessions,human systems,systemic, systematic, souwlork, systems thinking,
consultation, counse lling,counseling, effective, telephone coaching, phone coaching, Skype |
| relationship, problems, blocks, emotional |
soulwork.net - rank der domain 949759 (389061 in US)
|
|
| zum Seitenanfang ↑ |
| Life Coaching Institute |
| One of The Best Life Coaching Courses available |
| http://www.inst.org/coach/index.htm |
| Become a certified life coach, with the help of a diploma home-study course. |
| Accredited diploma life coaching courses for all abilities, tutored online life coaching courses to fit your circumstances. |
| life coaching course,life coach courses,life,courses,online,coaching |
| coaching, institute, career, contact, course, pagetracker, become, professional, become, courses, do cument, gajshost, taking, already, without, australia, others, students, overbrook, wedmore, 3459019 , growing, business, initdata, somerset, centre, poolbridge, blackford, trackpageview, unescape, 3cs cript, location, protocol, google, javascript, script, analytics, gettracker, petrusic, sydney, hest er, burnett, amazing, africa, province, encouragement, southampton, coaching, session, grades, const ant |
inst.org - rank der domain 408725 (12807 in GB)
|
|
| zum Seitenanfang ↑ |
| 24-7coaching.com |
| The World's #1 Development Portal - assisting members in over 100 countries. |
| http://www.247coaching.com |
| Online coaching resource for coaching clients, coaches, managers, executives, entrepreneurs. |
| 24-7coaching.com is assisting members in 75 countries with motivation, personal development, coachin g, goal setting, seminars, training and development, career development, sales seminars, business de velopment, leadership development, life coach training, employee motivation, weight loss motivation, self motivation |
| motivation, personal development, coaching, goal setting, seminar, training and development, career development, sales seminar, business development, leadership development, life coach training, emplo yee motivation, weight loss motivation, self motivation |
| motivation, development, development, training, weight, employee, career, seminar, seminars, persona l, personal, business, 7coaching, leadership, coaching, setting, business, assisting, people, countr ies, members, training, leadership, coaches, career, setting, millions, motivation, seminars, coachi ng, speaker, select, typeplease, growth, slmlife, course, therapist, expert, development, already, m ember, addresspasswordmembership, hereemail, business, corporate, acrobat, reader, daniels, listing, download, policy |
| (SLD : 247coaching.com) |
|
| zum Seitenanfang ↑ |
| Health/Alternative/Coaching/Professional_Resources |
|
|
| Health/Alternative/Coaching/Professional_Resources |
| zum Seitenanfang ↑ |
| 1 to1 Coaching Network |
| Business and Executive Coaching Practice Support |
| http://www.1to1coachingnetwork.com |
| Global certified business, executive and life coaching courses for coaching professionals. |
| Global business and executive coaching practice support. |
| business coaching, coach, coaching, coaching school, organizational coaching, executive coaching, co aching course, life coaching, professional coach, training. |
| coaching, master, institute, coaching, business, professionals, course, practice, qualified, course, executive, behavioral, professional, change, coaches, certified, organizations, development, people , persons, practices, certification, singapore, leading, behavioral, business, organizational, recog nized, specific, including, learning, designation, london, experienced, support, industry, industry, graduate, developers, models, techniques, saatchi, sydney, regional, countries, programs, specialis t, practice, executive, support, proven |
| (SLD : 1to1coachingnetwork.com) |
|
| zum Seitenanfang ↑ |
| Peer Resources |
| Peer Resources: Coaching Directory Index |
| http://www.peer.ca/coaching.html |
| Up-to-date resources, information, reviews for coaches, mentorship programs, and peer assistance. |
| Peer Resources index to all coaching schools, coaching services, certification, coaches, and coachin g resources. |
| coach, coach training, be a coach, coaching schools, accreditation, certification, executive coach, business coach, personal coaches, coaching literature, coaching news, coaching events, coaching semi nars, coaching conferences |
| document, getelementbyid, comein, crossheader, resources, coaching, directory, function, parseint, s lidein, contact, privacy, assistance, copyright, mentoring, layers |
peer.ca - rank der domain 858351 (16703 in CA)
|
|
| zum Seitenanfang ↑ |
| Achievement Specialists |
| Life Coach Training, Life Coaching Course | Business Coach Achievement Freebies |
| http://www.achievementspecialists.co.uk |
| Certified life coach training. Accredited by European Coaching Institute/ Open College Network diplo ma. |
| Our life coach training a diploma level course accredited and supported by the life coaching expert Curly Martin. Bestseller ‘The Life Coaching Handbook’, The Business Coaching Handbook, Personal Succ ess Handbook,Expert Curly Martin Achievement Spececialist |
| Life coaching, life coach, business coach, executive coach, corporate coach, Achievement Specialists , Curly Martin,distant learning courses, home learning course, life coach training, life coaching t raining, BBC, London Heathrow, Management Development, Management Training, Achievement Specialists, Business Coaching, Catalyst Coaching, Coach Training, Coach Training Alliance, Coaching Academy, Ic oach, Leadership Coaching, Life Coach Course, Life Coach Training, Life Coaching Course, New U Coach ing, Noble Manhattan, coaching academy, Tony Robins, Catalyst, BBC interviews, International Instit ute Coaching, Association of Coaching, Recession, performance coaching, clients, customers, workshop s, courses, 1-1 clients, rugby coach, golfer, crisis action plan, business referrals, training, reci eved, recommended reading, bestselling book, University of Derby, Business Coaching, 30 minute life coach, life coaching insurance, newsletter, testimonials from recent courses, Government Standards, freephone, Personal deve |
| coaching, coaching, achievement, handbook, martin, specialists, coaches, business, become, course, t raining, programme, diploma, international, development, coaches, during, courses, london, prices, r equired, techniques, everything, support, trained, giving, recession, effective, outstanding, succes sful, practice, business, skills, published, details, diploma, institute, course, acclaimed, highly, information, offers, author, pagetracker, designed, gajshost, opportunity, bestselling, document, r edundancy, change |
achievementspecialists.co.uk - rank der domain 987035 (28645 in GB)
|
|
| zum Seitenanfang ↑ |
| Coach Institute of Ireland |
| Diploma in Business, Executive & Personal Coaching 2010-2011 |
| http://www.coachinstitute.ie/ |
| Training for individuals wanting to work as business or life coaches. |
| Personal coaching and business coaching training from the Coach Institute of Ireland |
| business coaching,personalcoach training organisation,pratical coaching,womens business coaching,lea ding coach training ...,business coaching mentoring,business coaches international,executive busines s coaching,executive coaching training,executive coaching program,coach industries group,executive c oaching services,coaching,executive coaching,business coaching,life coach coaching,life coaching,coa ching & mentoring skills,business coach, |
| coaching, business, personal, ireland, programme, institute, training, executive, diploma, backgroun ds, development, management, leadership, association, individuals, professional, service, coachinsti tute, grounded, effective, benefit, directed, galway, design, looking, endorsed, salthill, enhance, motivated, resources, helping, professions, impact, awareness, psychology, publications, directors, principles, indepth, coaching, contact, centered, client, ireland, consultant, leaders, testimonials , course, choose, events, prestigious |
| (SLD : coachinstitute.ie) |
|
| zum Seitenanfang ↑ |
| New England Coaching |
| Certified Professional Coach Training, Emotional Intelligence Training, Executive Coaching |
| http://www.newenglandcoaching.com/ |
| Executive coaching, emotional intelligence and iPEC coach training for New England, US. |
| New England Coaching is a premier provider of training, education and coaching services including cu stomized individual and/or corporate programs. |
| organizational performance, leadership skills, professional coach training, coach certification, lif e potentials training, emotional intelligence certification, emotional intelligence training, leader ship development, executive coaching, life coaching, personal coach, business mentoring, ipec, genos , genos emotional intelligence |
| coaching, certification, document, function, possibility, coaching, intelligence, emotional, icpform 3804, training, executive, fadeduration, program, testimonials, training, professional, information, contact, quoterotate, development, numquotes, fadeoutduration, corporate, business, fields, provide s, clients, looking, organization, services, quoterotator, switchoffautohideshow, swfobject, return, tutorial, registration, required, programs, workshop, 000000, programs, location, england, protocol , quotes, learning, process, interactive, quoterotator, getelementbyid, skills |
| (SLD : newenglandcoaching.com) |
|
| zum Seitenanfang ↑ |
| LifeMappers |
| +LifeMappers (Australia) ++Life Coaching - helping you to get to where you want to go |
| http://www.lifemappersaustralia.com/ |
| Become a certified coach via an interactive distance learning diploma programme. Australia. |
| LifeMappers (Australia). Coaching for empowerment, resilience and success. Coaching and life coach t raining to become a registered LifeMapper Coach. |
| success coaching, life coaching, life coach training, online telephone coaching, free personality pr ofiler, relationships, career decisions, stress management, lifestyle choices, work stress |
| helping, lifemappers, australia, coaching |
| (SLD : lifemappersaustralia.com) |
|
| zum Seitenanfang ↑ |
| Coach to Coach Network |
| Coach2Coach : Coach to Coach Network (C2CN) |
| http://finance.groups.yahoo.com/group/coach2coach/ |
| A peer-to-peer community of over 900 coaches worldwide. The network really is the executive and busi ness coaching industry. |
| Coach2Coach: Coach to Coach Network (C2CN) |
| Coach2Coach, Industry Associations |
| window, searches, coach2coach, document, ygmapromo, ygmabt, function, object, groups, getelementbyid , margin, offline, posted, newsletter, johnagno, padding, search, network, groups, yahoogroups, thef ield, setattribute, return, weight, undefined, ygmabtpromo, popularsearches, typeof, instructions, 1 3811714, script, 13105339, 5857106, 12621715, coached, xrewbtj8fbs, 1705001380, djuv5gkjinq2b6d6ld3p vqaiti4vwkxhevsaaszh, coaches, coaching, 163780, subscribe, coaching, 3d650008, custom, farnam, posi tion, others, decisions, message, individual |
yahoo.com - rank der domain 4 (4 in US)
|
|
| zum Seitenanfang ↑ |
| Northern Colorado Coaches Alliance |
| Northern Colorado Coaches Alliance: Support for the coaching profession |
| http://www.nccoaches.org |
| A group of coaches in Colorado who support our member coaches as well as the coaching profession in general. |
| A group of coaches in Northern Colorado whose purpose is to support our member coaches as well as th e coaching profession in general. |
| Northern Colorado Coaches Alliance, Back Porch Gang, Northern Colorado Chapter of ICF, nccacoaches.o rg, coaches in Northern Colorado, Colorado coaches, coaches in Fort Collins, charter chapter of ICF, personal success, professional success, life coaches, relationship coaches, business coaches, succe ss coaching, leadership coaching, corporate coaching, executive coaching, motivational speakers, spe akers, management coaching, leadership development, happiness coaching, stress coaching, personal gr owth, professional growth, spiritual growth, spiritual coaches, personal mentors, business mentors, transitions, life transitions, change, more time, balance, better lives, life planning, choice, pers onal development, professional development, balanced living, vision quest |
| coaches, alliance, northern, colorado, coaching, support, profession |
| (SLD : nccoaches.org) |
|
| zum Seitenanfang ↑ |
| Coaching and Leadership |
| Coaching and Leadership International Inc. |
| http://www.coachingandleadership.com/ |
| A coaching, consulting and training company. Victoria BC, Canada. |
| CLI licenses our training programs, featuring PCMK |
| BC, Victoria, Brentwood Bay, Canada, life coach training certification, executive business coaching, corporate business coaching, leadership development, personal development, The Brain Walk |
| repeat, center, margin, background, images, shadow, family, weight, coaching, height, spirit, betska , script, location, document, gajshost, decoration, padding, bottom, pagetracker, 878787, leadership , international, gathering, president, professionals, largest, mumbai, profession, receives, unescap e, javascript, google, analytics, trackpageview, 11700814, gettracker, 3cscript, search, contact, pr ivacy, members, protocol, present, 008475, border, function, tahoma, wrapper, fff9b5, b70e0e |
| (SLD : coachingandleadership.com) |
|
| zum Seitenanfang ↑ |
|
