| GameSpy |
| Harry Potter and the Half-Blood Prince - Xbox 360 - GameSpy |
| http://xbox360.gamespy.com/xbox-360/harry-potter-and-the-half-blood-prince/ |
| Provides information and screenshots. |
| Harry Potter and the Half-Blood Prince Xbox 360 at GameSpy - Check out the latest Harry Potter and t he Half-Blood Prince cheats, cheat codes, walkthroughs, guides, videos and more! |
| Harry Potter and the Half-Blood Prince, Harry Potter and the Half-Blood Prince Xbox 360, Harry Potte r and the Half-Blood Prince X360, Harry Potter and the Half-Blood Prince cheats, cheat codes, walkth oughs, guides |
| tokens, document, ataxscript, typeof, pagetype, ubtscript, undefined, tokens2, potter, gamespy, writ eln, indexof, nuconomy, onload, oldwinonload, prince, location, function, akamai, getusernamefromign login, window, logger, showstitial, forwardedbystitial, ataximg, length, metadata, layer1, release, electronic, hogwarts, delimited, expressly, string, convert, setcontentmetadata, corpfooter, addenct oloc, substring, random, remove, gamespy, execute, nuconomy, tracking, gettime, akamai, change, tran sparent, logactivity, projecttoken |
gamespy.com - rank der domain 8811 (3372 in US)
|
|
| zum Seitenanfang ↑ |
| IGN |
| IGN: Harry Potter and the Half-Blood Prince |
| http://xbox360.ign.com/objects/142/14248952.html |
| Screenshots, videos, news, and a message board. |
| IGN is the ultimate Harry Potter and the Half-Blood Prince resource for trailers, screenshots, cheat s, walkthroughs, release dates, previews, reviews, soundtracks and news. |
| Harry Potter and the Half-Blood Prince trailers, screenshots, cheats, walkthroughs, release dates, p reviews, reviews, soundtracks, guides, spoilers, forums, news |
| tokens, document, ataxscript, typeof, pagetype, ubtscript, undefined, tokens2, potter, prince, oldwi nonload, nuconomy, indexof, writeln, gamespy, onload, function, location, updates, forwardedbystitia l, showstitial, ataximg, metadata, length, akamai, logger, window, getusernamefromignlogin, reviews, message, cheats, community, layer1, videos, boards, walkthroughs, upcoming, guides, previews, chang e, execute, projecttoken, logactivity, 3e17decd, random, nuconomy, browse, tracking, akamai, transpa rent, gettime |
ign.com - rank der domain 347 (164 in US)
|
|
| zum Seitenanfang ↑ |
| Team Xbox |
| Harry Potter and the Half-Blood Prince (Xbox 360) |
| http://games.teamxbox.com/xbox-360/1991/Harry-Potter-and-the-HalfBlood-Prince/ |
| News, and screenshots. |
| Harry Potter and the Half-Blood Prince for Xbox. Harry Potter and the Half-Blood Prince Xbox Reviews , Harry Potter and the Half-Blood Prince Xbox Cheats, Harry Potter and the Half-Blood Prince Xbox Mo vies, Harry Potter and the Half-Blood Prince Xbox Screenshots, Harry Potter and the Half-Blood Princ e Xbox Downloads, Harry Potter and the Half-Blood Prince Xbox News, Harry Potter and the Half-Blood Prince Xbox Previews, and more! |
| xbox, xbox 360, xbox cheats, xbox games, xbox reviews |
| teamxbox, reviews, hardware, potter, prince, document, reader, forums, guides, contact, screenshots, articles, cheats, txbase, previews, players, fraught, hogwarts, survive, return, chance, reviewspre viewsmoviesscreenshotsinterviewscheatsnews, ingredients, victory, players, quidditch, gryffindor, si detracked, wizard, exciting, magical, potions, engage, content, sections, features, events, intervie ws, editorials, heroes, fileplanet, gamespy, entertainment, gamestats, direct2drive, battlefield, se arch, downloads, sweepstakes, scrapbook, release |
teamxbox.com - rank der domain 32225 (12070 in US)
|
|
| zum Seitenanfang ↑ |
| Games/Video_Games/Action-Adventure/H/Harry_Potter_Series/Harry_Potter_and_the_Half-Blood_Prince |
|
|
| Games/Video_Games/Action-Adventure/H/Harry_Potter_Series/Harry_Potter_and_the_Half-Blood_Prince |
| zum Seitenanfang ↑ |
| 1UP |
| Harry Potter and the Half-Blood Prince Preview |
| http://www.1up.com/do/previewPage?cId=3168791&p=4 |
| Preview, by Andrew Hayward: "We've certainly seen more than our share of forgettable motion controls tacked onto forgettable licensed games since the Wii's launch, but we're fairly impressed by what E A is cooking up with the latest Harry Potter game." |
| |
| |
| potter, prince, margin, twitter, electronic, bottom, featuredblogs, previews, motion, padding, anoth er, previews, publisher, developer, release, quidditch, experience, screens, action, potion, larger, footage, controls, phoenix, redemption, fantasy, screen, various, previews, action, crackdown, nint endods, launch, latest, forgettable, border, height, though, version, making, videos, reviews, inter esting, features, cheats, boards, community, through, collection, speedrun, wishlist |
1up.com - rank der domain 8492 (3248 in US)
|
|
| zum Seitenanfang ↑ |
| Yahoo! Games |
| Games > Harry Potter and the Half-Blood Prince Preview |
| http://uk.videogames.games.yahoo.com/48/harry-potter-and-the-half-blood-prince-f4a448.html |
| Preview: "The game's looking promising, but we'll have to wait until later in the year to discover w hether it can deliver on the claims of its makers and replicate the gigantic popularity of its inspi ration." |
| WII Harry Potter and the Half-Blood Prince Review from Yahoo! Video Games UK. Find out more about th e latest Wii HASH(0x92bf120) game: Harry Potter and the Half-Blood Prince. Review of Harry Potter an d the Half-Blood Prince game |
| |
| window, prince, potter, search, previews, object, dbeff4eem, preview, series, ongoing, hollywood, vi deogames, however, course, recreation, screen, incomplete, points, undeniable, history, demonstratin g, crowbar, struggling, oftentimes, chequered, something, penultimate, further, coming, 200480570, 3 dhead, 202485764, 201108091, 3d200059816, 3d200475677, homenewsreviewspreviewscheatswalkthroughsscre enshots, 360pcpspdsgbangcxboxspecialsdownloads, ps2ps3wiixbox, 13onfkfpn, mailsearchthe, ireland, up games, fantasy, popular, impossibly, rowling, dramatic, narrative, finish, yudbeff4eem, 12cn0bd3m |
yahoo.com - rank der domain 4 (4 in US)
|
|
| zum Seitenanfang ↑ |
| GameZone |
| Harry Potter and the Half-Blood Prince - GameZone - Products |
| http://ps3.gamezone.com/gamesell/p35263.htm |
| News, trailers, screenshots, and links. |
| 'Find the latest Harry Potter and the Half-Blood Prince game reviews, news, downloads, cheats, and m ore |
| 'Harry Potter and the Half-Blood Prince PlayStation 3 game |
| potter, prince, cheats, reviews, output, forums, videos, downloads, unescape, gamezone, previews, su bstring, players, return, rating, review, survive, hogwarts, comment, facebook, fraught, sharing, re ddit, twitthis, stumbleupon, quidditch, gryffindor, victory, players, sidetracked, potions, chance, engage, exciting, wizard, magical, ingredients, innerhtml, create, account, gamezone, publishers, ip hone, developers, events, gamezone, addlinktracker, addevent, window, forgot, nzgundyundcumtk0 |
gamezone.com - rank der domain 15551 (5779 in US)
|
|
| zum Seitenanfang ↑ |
|
