| Atlanta Concrete Engraving |
| Atlanta Concrete Engraving - A Decorative Concrete Contractor |
| http://www.atlantaconcreteengraving.com/ |
| A decorative concrete contractor. Shown are examples, services, FAQ and contacts. |
| Atlanta concrete engraving - your decorative concrete contractor |
| Atlanta concrete engraving, atlanta concrete engraving, concrete engraving, decorative concrete,
At lanta decorative concrete, concrete art work, art concrete, decorative concrete floor,
concrete de corative stamp, decorative concrete coating, concrete decorative finish,
block concrete decorative, decorative concrete flooring, decorative concrete contractor |
| concrete, engraving, atlanta, engraving, concrete, surfaces, atlanta, decorative, exterior, patented , revolutionary, interior, sealing, specializes, contractor, staining, process, 4084744, urchintrack er, copyright, ordinary, transforms, patterns, beautiful, affordably, templates, contact, contractor , gallery, services, staining, visiting, decorative, concreteacid, optimisation, search, engine |
| (SLD : atlantaconcreteengraving.com) |
| Regional/North_America/United_States/Georgia/Localities/M/Marietta/Business_and_Economy/Construction_and_Maintenance |
| zum Seitenanfang ↑ |
| Radiatoare Decorative |
| Radiatoare Decorative |
| http://www.radiatoare-decorative.ro |
| Magazin online de radiatoare decorative de oţel, aluminiu, fontă, granit, convectori pentru case, vi le şi clădiri de birouri |
| Sistem de plata - money via e-mail |
| sitem de plata |
| decorative, radiatoare |
| (SLD : radiatoare-decorative.ro) |
| World/Română/Cumpărături_online/Casă_şi_grădină/Materiale_de_construcţii |
| zum Seitenanfang ↑ |
| Decorative |
|
|
| Decorative |
| zum Seitenanfang ↑ |
| Beautiful Pillows Inc. |
| Beautiful Pillows and Home |
| http://beautifulpillowsandhome.com/ |
| Hand-sewn decorative pillows with a down/feather fill. Features shipping and return information and order tracking. |
| Beautiful Pillows is the largest online catalog for decorative pillows. |
| beautiful pillows, david mitchell, paisley accent pillow, decorative crested or beaded pillows, bead ed accent pillows, decorative crested, beaded pillows, beautiful pillows, david mitchell, paisley ac cent pillow, decorative pillows modern, decorative pillows contemporary, home furnishing retail list , decorative country, decorative country pillows, beaded decorative pillows, leather decorative pill ows, leather decor, red orange yellow throw pillows, hawiian print throw pillows, black decorative p illows, big couch pillows, gold throw pillows, pillows fun, fun pillows, modern designer pillows, de corative suede pillows, decorative silk pillows, chenille decorative pillows, cotton pillows, cheap decorative floor pillows, marketing decorative pillows, homemade decorative pillows, interior design ers, Karen Gomes, Roselene Gomes |
| blockquote, pillows, margin, beautiful |
| (SLD : beautifulpillowsandhome.com) |
| Shopping/Home_and_Garden/Soft_Furnishings/Cushions_and_Decorative_Pillows |
| zum Seitenanfang ↑ |
| Tole and Decorative Painting Studio |
| A cozy decorative painting studio in rural Ottawa! A great getaway! |
| http://www.earmark-decorative-painting-studio.com |
| Teaching decorative painting studio focused on technique as a means for self-expression. Some free t ips and projects. |
| A very comfortable and relaxing decorative painting studio and classroom catering to all painting le vels. |
| decorative painting, art studio, Kanata, Ottawa |
| border, addsiteto, margin, padding, verdana, background, questionmark, center, 000000, bottom, famil y, ffffff, weight, painting, decorative, studio, earmark, display, welcome, subscribe, ottawa, studi o, getaway, painting, helvetica, geneva, decorative, navheader |
| (SLD : earmark-decorative-painting-studio.com) |
| Arts/Crafts/Decorative_Painting |
| zum Seitenanfang ↑ |
| Decorative |
|
|
| Decorative |
| zum Seitenanfang ↑ |
| MADP - Montreal Area Decorative Painters |
| Montreal Area Decorative Painters |
| http://madp.ca:8080/ |
| Guild with a goal to promote decorative painting. Includes history, tips and techniques, directions, image gallery, and details of membership, workshops, seminars, community projects and their annual exhibition and sale. |
| Montreal Area Decorative Painters |
| MADP, Montreal Area Decorative Painters, decorative painting |
| eacute, montreal, painters, decorative, urchintracker, 1130600, artistes, coratif |
| (SLD : madp.ca:8080) |
| Arts/Crafts/Decorative_Painting/Associations |
| zum Seitenanfang ↑ |
| Deanne's Decorative Arts |
| Deanne's Decorative Arts |
| http://www.deanneart.com/ |
| Packets, books, supplies, brushes and seminar schedule. Also some free items. |
| |
| tole, painting,tole painting,Deanne,Fortnam,SDP,decorative,decorative painting,acrylic,packets, semi nar,still,life,fruit,flowers, Society of Decorative Painters |
| browser, support, deanne, decorative, frames |
| (SLD : deanneart.com) |
| Shopping/Crafts/Supplies/Decorative_Painting/Patterns |
| zum Seitenanfang ↑ |
| Decorative Films, LLC |
| Decorative Films - Decorative Window Films, Stained Glass, Privacy |
| http://www.decorativefilms.com |
| Manufacturer and distributor of SOLYX decorative glass enhancement films for interior design, archit ectural applications and the window film industry. |
| Decorative Films, LLC provides decorative window film, stained glass window film, window privacy fil m, and frosted glass films. |
| decorative films, decorative film, decorative window film, decorative window films, stained glass wi ndow film, winow privacy film, frosted glass films |
| decorative, height, style1, navunder, stained, window, privacy |
| (SLD : decorativefilms.com) |
| Shopping/Home_and_Garden/Windows/Window_Coverings/Film_and_Tinting |
| zum Seitenanfang ↑ |
| Dekoratif Beton Kaplama Sistemleri |
| Flex-C-Ment Decorative Concrete | Stamped Concrete Overlay Systems |
| http://www.dekorbeton.com |
| Flex-c-ment Türkiye distribütörü Kor-Tek İnşaat'a ait sitede ürün hakkında teknik bilgiler ve uygula ma resimleri bulunuyor. |
| Flex-c-ment Decorative concrete products and stamped concrete overlay system are based on a cementit ious dry mix designed specifically for deep wall textures, creating the appearance of various Stone and brick patterns. |
| decorative concrete, imprinted concrete, decorative concrete flooring, decorative concrete floor, de corative concrete supply, concrete overlay, brick siding, decorative concrete overlay, decorative st amped concrete, decorative concrete product, decorative concrete system, decorative concrete store, floor concrete product, imprinted concrete product, concrete overlay product, stamped concrete produ ct, stamped concrete overlay, floor concrete overlay, concrete stamping pattern, stamped concrete. |
| concrete, systems, stamped, decorative, overlay |
dekorbeton.com - rank der domain 612042 (18586 in GB)
|
| World/Türkçe/Ekonomi_ve_İş_Dünyası/Yapı_Sektörü/Yapı_Malzemeleri |
| zum Seitenanfang ↑ |
| Decorative Puzzles |
| Decorative Puzzles |
| http://www.decorativepuzzles.co.uk/ |
| Decorative wood puzzles in bowls and trays, designed for play and display as art objects. Outlets, s hows attended and ordering details. Based in Cornwall. |
| Decorative wood puzzles in bowls and trays designed for play and display as art objects |
| Decorative Puzzles,decorative puzzles,Art Puzzles,Wood Puzzles,Puzzle Designs,Display Puzzles,Tessel ations,pentominoes,hexiamonds,woodturning,fretwork |
| puzzles, decorative |
| (SLD : decorativepuzzles.co.uk) |
| Regional/Europe/United_Kingdom/Recreation_and_Sports/Hobbies/Crafts/Toys |
| zum Seitenanfang ↑ |
| Increte Systems |
| Decorative Concrete Coating Decorative Concrete Resurfacing Decorative Concrete Flooring |
| http://www.increte.com/ |
| Manufactures materials for stamped or stained concrete, decorative walls, and concrete overlay syste ms. |
| Increte offering Decorative Concrete, Decorative Concrete Coating, Decorative Concrete Resurfacing, and Decorative Concrete Flooring. |
| concrete, decorative concrete, decorative concrete coating, decorative concrete resurfacing, decorat ive concrete flooring, concrete products, stamped concrete, concrete overlay product, imprinted conc rete, concrete chemicals, architectural concrete, concrete paving, concrete flooring, textured concr ete, decorative surfacing, architectural paving |
| return, componentart, function, document, offsetparent, progid, dximagetransform, microsoft, concret e, parseint, irisstyle, browser, slidetype, activegrouplist, currentid, motion, information, hellip, offsettop, gallery, system, ocontrol, clientsidecommand, offsetleft, expandtimeoutgroupindex, expan dedgroupindex, display, increte, texture, tagname, natural, expanddelay, collapseexpandedgroups, gro upstate, spostid, isboxon, residential, commercial, contextmenu, surfaces, colors, gradientsize, wip estyle, patterns, focusgroupindex, navigateurl, pageviewid, pgmrgmsr, durable, applications, excitin g |
increte.com - rank der domain 847451 (0 in US)
|
| Business/Construction_and_Maintenance/Materials_and_Supplies/Concrete/Decorative_Finishes |
| zum Seitenanfang ↑ |
| Novamoda Decorative Ceramics |
| Novamoda Decorative Ceramics |
| http://www.novamodadecor.com/ |
| An international supplier of fashion decor, decorative tiles and cut tile borders. |
| |
| |
| ceramics, novamoda, decorative |
| (SLD : novamodadecor.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Wall,_Floor_and_Decorative_Finishes/Tile |
| zum Seitenanfang ↑ |
| Flags for Sail |
| Seasonal flags, garden flags, decorative flags, flag accessories
flags |
| http://flagsforsail.com |
| Offers a variety of flag designs for holidays and seasons. |
| seasonal yard flags, outdoor seasonal flags, country decorative flags, outdoor decorative flags, dec orative house flags, decorative flags for the house, holiday banner flags, decorative garden flags |
| garden flags, seasonal flags, decorative flags, outdoor flags, house flags, holiday flags, decor ative garden flags, mini garden flags, flags |
| organizer, receive, flagsforsail, categories, certificates, accessories, decorative, garden, seasona l |
| (SLD : flagsforsail.com) |
| Shopping/Home_and_Garden/Flags_and_Banners/Decorative |
| zum Seitenanfang ↑ |
| Mitchell's Decorative Hardware |
| Mitchell's Decorative Hardware |
| http://www.mitchellhardware.com/ |
| Online ordering for decorative hardware and other home improvement items. |
| |
| |
| browser, support, mitchell, decorative, hardware, frames |
| (SLD : mitchellhardware.com) |
| Shopping/Home_and_Garden/Home_Improvement/Hardware |
| zum Seitenanfang ↑ |
| Saturn Plastics Corp. |
| Decorative Cast Acrylic Sheet, Rods, and Balls |
| http://users1.50megs.com/saturn/ |
| Manufacture of decorative cast acrylic sheets, rods, and balls in a range of colors, including pearl , glitter, marble, and granite. |
| Manufactures and distributors of decorative cast acrylic rods, decorative cast acrylic balls, and de corative cast acrylic sheet.Pearl,Glitter,granite. |
| manufacture, distributor, decorative, rod, acrylic, balls, cast, sheet, sign, jewelry, acrylic, disp lay, decorative, material, marbles, cast, acrylic, pen blanks, derorative, glitter, marble, granite, pearl, decorative, acrylic, cast, |
| border, 8099b3, background, family, acrylic, decorative |
50megs.com - rank der domain 30702 (11366 in US)
|
| Business/Chemicals/Polymers/Plastics/Manufactured_Product/Film,_Sheet,_and_Tape |
| zum Seitenanfang ↑ |
| Artifex Decorative Painting Studio |
| Artifex Decorative Painting Studio |
| http://www.artifexstudio.com |
| Design and installation of decorative paint finishes. Project portfolio, product information. (Flash required) |
| |
| |
| settings, screen, window, height, myname, mypage, features, decorative, newwindow, studio, painting, function, artifex |
| (SLD : artifexstudio.com) |
| Regional/North_America/Canada/Ontario/Localities/O/Ottawa/Business_and_Economy/Home_and_Garden/Interior_Design |
| zum Seitenanfang ↑ |
| Stone System Co. |
| Stone International Decorative concrete, stamped concrete, vertical concrete overlay |
| http://www.stonesystem.com/ |
| Manufacturers products for producing stamped and decorative concrete. |
| Stone International stamped concrete - Manufacturer decorative concrete products and stamped concret e overlay. Offers various stone and brick patterns for vertical stamping concrete. |
| Stamped concrete, decorative concrete, imprinted concrete, decorative concrete flooring, decorative concrete floor, decorative concrete supply, concrete overlay, decorative concrete overlay, decorativ e stamped concrete, decorative concrete product, decorative concrete system, decorative concrete sto re, floor concrete product, imprinted concrete product, concrete overlay product, stamped concrete p roduct, stamped concrete overlay, floor concrete overlay, concrete stamping pattern, stamped concret e |
| concrete, international, concrete, overlay, flooring, decorative, vertical, stamped, topping, decora tive, stamps, stamping, aggregate, decowall, products, products, imprinted, stamped, market, sheets, technology, exposed, foreign, stores, extraordinary, acquired, course, industrial, exposed, vertica l, sprayconcrete, column, always, traditional, gallery, success, leader, training, concreteconcrete, courses, meetings, websites, stampedconcretewall, verticalstamping, chinese, traditional, croatianc zechdanishdutchestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesi anirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueser omanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish, latest, simplified, languageenglishafrikaansalbanianarabicbelarusianbulgariancatalanchinese, microt op |
stonesystem.com - rank der domain 964040 (18065 in IT)
|
| Business/Construction_and_Maintenance/Materials_and_Supplies/Concrete/Decorative_Finishes |
| zum Seitenanfang ↑ |
| Leeway Decorative Shutters |
| Shutters | Window Shutters | Decorative Shutters |
| http://www.ukshutters.co.uk/ |
| Online brochure covering a range of decorative shutters and other exterior products. |
| Online brochure covering a range of decorative external shutters and other exterior products. |
| shutters, window shutters,decorative shutters |
| shutters, shutters, shutters, window, window, queries, please, window, sitemap, louvre, articles, tr ansform, urchintracker, decorative, 328501, transform, maintenance, decorative, exterior, install |
| (SLD : ukshutters.co.uk) |
| Regional/Europe/United_Kingdom/England/West_Midlands/Birmingham/Business_and_Economy/Home_and_Garden |
| zum Seitenanfang ↑ |
| Stencilers and Decorative Artists Guild |
| SDAG ~ Stencilers and Decorative Artists Guild |
| http://www.stencilers.org/ |
| Organization formed to promote and perpetuate the art of stenciling and related decorative arts. |
| The Stencilers and Decorative Artists Guild promotes stenciling and decorative arts. |
| |
| stencilers, circle, pagetracker, artists, decorative, gajshost, receive, document, annual, friends, membership, conference, decorative, membership, however, script, 311627, initdata, trackpageview, at tend, directory, gettracker, standards, javascript, location, google, analytics, opportunity, protoc ol, unescape, 3cscript, krefta, copyright, industry, highest, design, benefits, stencil, california, circle, without, bridges, instead, reaches, impossible, angeles, officers, bylaws, history, confere nces, newsletter |
| (SLD : stencilers.org) |
| Arts/Crafts/Decorative_Painting/Associations |
| zum Seitenanfang ↑ |
| Decorative Artist's Workbook |
| Decorative Artist's Workbook, America's favorite how-to magazine for decorative artists |
| http://www.decorativeartist.com/ |
| Their mission is to inspire, instruct, inform and entertain decorative painters across the country a nd around the world. |
| Decorative Artist's Workbook is packed with projects, tips and techniques for beginning, intermediat e and advanced decorative painters. The site includes free projects, painting tips, links to the bes t sites for decorative painters, and a free newsletter. |
| decorative art, decorative painting, decorative art magazine, acrylic projects, alkyd projects, porc elain painting, gouache, oil projects, craft shows, fabric painting, finishing, glass painting, oil painting, painting techniques, stenciling, watercolor painting, Decorative Artist's Workbook |
| artist, decorative, workbook, painting, issues, xheight, xwidth, creative, supplies, painting, recei ve, screen, decorative, height, magazine, favorite, filled, detailed, subscriber, creative, painters , information, sister, publications, clubthough, holidays, brushstroke, handbook, projects, current, decision, business, publication, available, publications, issueregrettably, availableback, discount s, newest, members, spectacular, difficult, videos, details, heartwarming, creativepaintingbookclub, instructions, decorativeartists, urchintracker, 500734, random |
| (SLD : decorativeartist.com) |
| Arts/Crafts/Decorative_Painting/Magazines_and_E-zines |
| zum Seitenanfang ↑ |
| Artezan.com |
| The Definitive Guide to Decorative Painting |
| http://www.artezan.com/ |
| Guide to decorative painting, folk art and tole painting. Definitions, history, techniques, styles a nd how-tos. |
| Decorative Painting Guide: Resources for all levels of decorative painters. Definition and origins o f decorative painting, features and history of traditional folk arts of bauernmalerei, canalboat pai nting, zhostovo, rosemaling, tole painting and hindeloopen, features and examples of contemporary de corative painting, how to use faux finishes in decorative painting, FAQs about learning decorative p ainting, tips and other decorative painting resources. |
| decorative painting, decorative painter, decorative art, folk art, bauernmalerei, canalboat painting , zhostovo, rosemaling, tole painting, hindeloopen |
| decorative, painting, painting, decorative, artezan, features, painter, definitive, answers, contemp orary, traditional, explore, contemporary, originate, frequently, cultures, various, traditions, exp lore, learning, number, visitor, sm4artezan, rights, reserved, contact, finishes, discover, learning , questions, finishes, origins, studio, kuwait, painters, accessories, matters, people, magazines, u nderstanding, glossary, resources, colour, brushes, gallery, varnishing, basecoating, history, steep ed, country, rustic |
| (SLD : artezan.com) |
| Arts/Crafts/Decorative_Painting |
| zum Seitenanfang ↑ |
| Decorative Concretors Warehouse |
| Sydney Decorative Concretors Warehouse |
| http://www.concretorswarehouse.com/ |
| Australian manufacturer, distributor and exporter of products for decorative concrete. |
| Sydney Decorative Concretors Warehouse specialises in the manufacture and supply of sealers (includi ng water based and solvent based), stencil, colour hardener, spray-on resurfacing and oxide add-mix |
| Sydney Decorative Concretors Wharehouse, stencil, colour hardener, spray-on resurfacing, oxide add-m ix, reseal, export, maintain |
| viewer, script, thumbnail, warehouse, sydney, decorative, concretors |
| (SLD : concretorswarehouse.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Concrete/Decorative_Finishes |
| zum Seitenanfang ↑ |
| Decorative Plumbing Distributors |
| Decorative Plumbing Distributors - Home |
| http://www.decorativeplumbing.com/ |
| Distributor of high end decorative plumbing fixtures and equipment. |
| |
| Decorative Plumbing Supplies, Decorative Plumbing Fixtures, Grohe Plumbing Fixtures, Hans Grohe Plum bing Fixtures, Ginger Faucets, Cucina Kitchen, CAB Fit, Allia, Andre Collection, Vola Fixtures, Gebr it, Sonia Bath Accessories, Plumbing Retailers, Plumbing Distributor, Bath Fixtures, Kitchen Fixture s |
| product, plumbing, distributors, decorative, stocked, popular, trained, warehouse, constantly, cabin et, country, distributors, unique, wholesalers, kitchen, dealers, hardware, stores |
| (SLD : decorativeplumbing.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Mechanical/Plumbing_Fixtures_and_Equipment |
| zum Seitenanfang ↑ |
| 145 Antiques and Decorative Objects |
| Welcome to 145antiques.com - Antiques and Decorative Fixtures |
| http://www.145antiques.com/ |
| Specializing in French 19th and 20th century furniture, seating, tables, lighting, garden items, and decorative objects. |
| |
| |
| 444444, helvetica, center, weight, verdana, family, decoration, 145antiques, background, height, 100 11tel, welcome, contactinfo, fixtures, decorative, letter, spacing, underline, visited, antiques |
| (SLD : 145antiques.com) |
| Regional/North_America/United_States/New_York/Localities/N/New_York_City/Manhattan/Business_and_Economy/Shopping/Antiques_and_Collectibles |
| zum Seitenanfang ↑ |
| Fiesta City Decorative Painters |
| Fiesta City Decorative Painters |
| http://members.cox.net/fiestacitydp/ |
| Santa Barbara/Goleta California Chapter of the National Society of Decorative Painters. |
| |
| |
| message, javafile, important, javafile, sentence, snappy, visible, visibility, absolute, position, f iesta, decorative, painters, spanstyle, family, gehrig, trailor, cursor, weight, verdana, provided |
cox.net - rank der domain 1189 (503 in US)
|
| Arts/Crafts/Decorative_Painting/Associations |
| zum Seitenanfang ↑ |
| Decorative Painter |
| Society of Decorative Painters |
| http://www.decorativepainters.org |
| The Society of Decorative Painters (SDP) magazine features leading decorative and tole painters usin g diverse mediums and techniques. |
| |
| |
| decorative, painting, conference, information, membership, painters, window, society, receive, membe r, painter, membership, members, project, online, platinum, decorative, online, special, application , business, products, follow, margin, facebook, members, version, everyone, painting, download, maga zine, copyright, wichita, subscribe, ornaments, intrust, issues, registration, contribution, cccccc, offered, border, instructions, november, decoart, accept, become, picture, details, website, smiths onian |
decorativepainters.org - rank der domain 940337 (404264 in US)
|
| Arts/Crafts/Decorative_Painting/Magazines_and_E-zines |
| zum Seitenanfang ↑ |
| The Decorative Laminates (India) Pvt. Ltd., |
| The Decorative Laminates (India) Pvt. Ltd., |
| http://www.angelfire.com/ak/dl786/index.html |
| Manufactures plywood and plastic laminated products, and furniture. |
| |
| |
| frames, browser, support, laminates, decorative, sandeep |
angelfire.com - rank der domain 1900 (773 in US)
|
| Regional/Asia/India/Karnataka/Localities/Mysore/Business_and_Economy |
| zum Seitenanfang ↑ |
| Decorative Sleeves |
| CCL LABEL Decorative Sleeves > Home |
| http://www.decorativesleeves.co.uk/ |
| Manufacturer of decorative shrink sleeves for packaging manufacturers. |
| |
| |
| pagetracker, sleeves, shrink, sleeves, decorative, gajshost, document, products, decorative, sleeves , disclaimer, protocol, location, policy, sitemap, 769319, 767097, privacy, cclind, google, 12963808 , gettracker, setdomainname, trackpageview, setallowlinker, script, norfolk, 3cscript, unescape, ana lytics, javascript, manufacturing, variety, including, sectors, market, suppliers, sleeve, usproduct scontact, homeabout, leading, welcome, drinks, impact, maximise, security, rollesby, estate, industr ial, hardwick, shapes |
| (SLD : decorativesleeves.co.uk) |
| Business/Industrial_Goods_and_Services/Packaging/Flexible |
| zum Seitenanfang ↑ |
| Rosalind Kelly |
| Rosalind Kelly | Tole and Decorative Painting |
| http://web.ukonline.co.uk/Members/gwv/index.htm |
| Offers a selection of pattern packs. |
| Rosalind Kelly - Tole and Decorative Painter |
| Painting,Tole Painting,Decorative Painting,tole painting,decorative painting,painting,tole books,tol e patterns,crafting,crafts,hobbies,floral,art & crafts |
| fastcounter, bcentral, painting, decorative, rosalind |
ukonline.co.uk - rank der domain 743396 (4068 in UK)
|
| Shopping/Crafts/Supplies/Decorative_Painting/Patterns |
| zum Seitenanfang ↑ |
| Decorative Faux Painting |
| Decorative Faux Painting, painting techniques made easy |
| http://decorative-faux-painting.com |
| Helpful information and instruction on faux painting techniques. Provides tips on various faux finis hes and the tools needed. |
| Learn how to do YOUR favorite decorative faux painting technique. And discover new techniques in fa ux finishing. |
| Decorative Faux Painting, painting techniques and instruction |
| painting, painting, decorative, techniques, border, padding, addsiteto, decorative, margin, finish, technique, beautiful, stenciling, colors, furniture, nothing, verdana, project, center, background, beauty, important, questionmark, started, interest, subscribe, favorite, contact, protecting, sugges tions, blogthe, additions, finishes, experience, question, blocks, overwhelming, youchoosing, perfec t, should, protectionpaint, protection, paintwhy, changes, paintingwhen, should, professionally, com ments, policydecorative, learned, commonly |
| (SLD : decorative-faux-painting.com) |
| Home/Home_Improvement/Painting/Specialized_Techniques |
| zum Seitenanfang ↑ |
| Stone S.a.s. |
| Stone International Decorative concrete, stamped concrete, vertical concrete overlay |
| http://www.stonesystem.com/ |
| [Roma] L'azienda realizza pavimenti stampati in calcestruzzo ed i prodotti necessari per la posa in opera e la rifinitura. Immagini di alcuni lavori eseguiti, schede tecniche e novità. |
| Stone International stamped concrete - Manufacturer decorative concrete products and stamped concret e overlay. Offers various stone and brick patterns for vertical stamping concrete. |
| Stamped concrete, decorative concrete, imprinted concrete, decorative concrete flooring, decorative concrete floor, decorative concrete supply, concrete overlay, decorative concrete overlay, decorativ e stamped concrete, decorative concrete product, decorative concrete system, decorative concrete sto re, floor concrete product, imprinted concrete product, concrete overlay product, stamped concrete p roduct, stamped concrete overlay, floor concrete overlay, concrete stamping pattern, stamped concret e |
| concrete, international, concrete, overlay, flooring, decorative, vertical, stamped, topping, decora tive, stamps, stamping, aggregate, decowall, products, products, imprinted, stamped, market, sheets, technology, exposed, foreign, stores, extraordinary, acquired, course, industrial, exposed, vertica l, sprayconcrete, column, always, traditional, gallery, success, leader, training, concreteconcrete, courses, meetings, websites, stampedconcretewall, verticalstamping, chinese, traditional, croatianc zechdanishdutchestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesi anirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueser omanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish, latest, simplified, languageenglishafrikaansalbanianarabicbelarusianbulgariancatalanchinese, microt op |
stonesystem.com - rank der domain 964040 (18065 in IT)
|
| World/Italiano/Affari/Edilizia/Materiali_e_Forniture/Pavimenti,_Pareti_e_Finiture_Decorative/Pavimenti_e_Rivestimenti/In_Cemento |
| zum Seitenanfang ↑ |
| Jeanne Downing Decorative Art Designs |
| Jeanne Downing Decorative Art Designs offers painting books, packets, videos, supplies, seminars for decorative artists |
| http://rosecote.com/ |
| Pattern packets, books, supplies, porcelain and china. Subscribe to The Journal, a painting magazine . |
| Rosecote synonomous with Jeanne Downing, supplies decorative art designs, decorative painting books, pattern packets, videos, painting supplies, and painting seminars for decorative artists desiring a romantic, victorian, expression of elegance. |
| decorative painting, decortive art, decorative artist, decorative art designs, Jeanne Downing, Rosec ote, Certified Decorative Artist, CDA, video tutorials, tole painting, pattern packets, decorative p ainting books, decorative painting videos, decorative painting seminars, travel teaching, decorative art magazines, painting supplies, oil paints, porcelain, china, tea, roses, victorian, romantic, Ex pressions of Elegance, Loveland, Colorado. |
| rosecote, background, jeanne, designs, downing, document, decorative, margin, repeat, elegant, cente r, biography, living, interest, newsletter, photos, seminars, classroom, auction, online, little, pa inting, copyright, website, jeanne, maintained, hosted, designed, offers, loveland, letter, artist, cc9999, limited, download, artists, paragraph, family, 660033, graphics, fffff0, helvetica, decorati ve, writing, packets, things, comments, seminars, compliments, journal, joined |
| (SLD : rosecote.com) |
| Shopping/Crafts/Supplies/Decorative_Painting/Patterns |
| zum Seitenanfang ↑ |
| Butterfield Color |
| Decorative Concrete Products by BUTTERFIELD COLOR | Home |
| http://www.butterfieldcolor.com/ |
| Offers a range of colored concrete supplies. |
| Decorative Concrete Products by Butterfield Color | Available World Wide |
| concrete products, decorative concrete products, concrete stamping tools, decorative concrete finish es, US, Canada, Europe, concrete acid stain, concrete overlay products, concrete colors, concrete fi nishes |
| butterfield, products, decorative, concrete |
butterfieldcolor.com - rank der domain 655241 (284654 in US)
|
| Business/Construction_and_Maintenance/Materials_and_Supplies/Concrete/Decorative_Finishes |
| zum Seitenanfang ↑ |
| Irina Burlaca - Tapestry, Print kerchief, Decorative artworks |
| Irina Burlaca - Tapestry, Print kerchief, Decorative artworks |
| http://www.irina.burlaca.com |
| Gallery of artworks: Tapestry, Print kerchief, Decorative artworks. |
| Personal website of Irina Burlaca, a plastic arts artist. Gallery of artworks: Tapestry, Print kerch ief, Decorative artworks. |
| tapestry, print kerchief, decorative artworks |
| kerchief, prefer, cromatical, tapestry, decorative, burlaca, different, gajshost, document, element, active, figurative, abstract, leather, tissue, technique, structural, decorative, because, nonfigur ative, artworks, thread, pagetracker, artwork, facture, traditions, trying, always, tapestry, struct ures, realised, surface, contrast, through, smooth, formed, besides, classical, bright, coated, fibr es, techniques, materials, process, stylization, google, analytics, 3cscript, unescape, 261588, trac kpageview |
burlaca.com - rank der domain 981044 (421446 in US)
|
| Arts/Crafts/Textiles/Weaving/Tapestry |
| zum Seitenanfang ↑ |
| Concrete Coatings Incorporated |
| Concrete Coatings - Home |
| http://www.concretecoatingsinc.com |
| Business opportunities in decorative concrete and concrete restoration. |
| Concrete Coatings Inc.in Utah provides training, materials, tools, and products needed for Architect ural Decorative Concrete and Concrete Coatings. |
| Concrete Coatings Inc. Layton,UT,Decorative Concrete Supplies,concrete floor coatings,concrete dye,e poxy floor coating,admixture,bonding agent,release,color hardener,Decorative Concrete Supplier,Archi techtural Concrete,Architectural Concrete Overlay,Concrete Stain,concrete sealer,concrete sealers,co ncrete colorant,concrete integral color,concrete patch material,concrete spray coating,decorative co ncrete coating,color concrete,floor coating,concrete stamping,acid stain,concrete repair,concrete re surfacing,decorative concrete,pool decks,decorative concrete flooring,stamped concrete,concrete poli shing,concrete forms,concrete floor coatings, industrial floor coatings,concrete finishes,concrete c oatings,concrete sealer,concrete coating,Increte,industrial floor coating,concrete floor coating,tex tured concrete,spray deck,resurface concrete,concrete sealers,decorative concrete staining,decorativ e concrete floor,decorative concrete floors,stamped concrete patio,cement stain,epoxy cconcrete coat ing,concrete stencils,co |
| concrete, coatings |
concretecoatingsinc.com - rank der domain 758529 (294006 in US)
|
| Business/Opportunities/Home_Based |
| zum Seitenanfang ↑ |
| Society of Decorative Painters (SDP) |
| Society of Decorative Painters |
| http://www.decorativepainters.com/ |
| International organization to promote decorative and tole painting. Offers national conventions, loc al chapters, certification programs, and "The Decorative Painter" magazine. |
| |
| |
| decorative, painting, conference, information, membership, painters, window, society, receive, membe r, painter, membership, members, project, online, platinum, decorative, online, special, application , business, products, follow, margin, facebook, members, version, everyone, painting, download, maga zine, copyright, wichita, subscribe, issues, ornaments, intrust, registration, contribution, cccccc, offered, border, instructions, november, decoart, accept, become, picture, details, website, smiths onian |
| (SLD : decorativepainters.com) |
| Arts/Crafts/Decorative_Painting/Associations |
| zum Seitenanfang ↑ |
| Ashridge Decorative and Fine Arts Society |
| ADFAS - Ashridge Decorative and Fine Arts Society |
| http://www.ashridgedfas.org.uk/ |
| Voluntary society promoting education, appreciation and study of the decorative and fine arts. Inclu des programme of events, gallery and a young arts section. |
| ADFAS - Ashridge Decorative and Fine Arts Society |
| ADFAS, NADFAS, Ashridge Decorative and Fine Arts Society, Ashridge, Decorative, Fine Art, Fine Arts |
| visits, decorative, decorative, society, lectures, activities, ashridge, nadfas, education, through, voluntary, welcome, preservation, groups, public, artistic, appreciation, national, societies, asso ciation, members, almost, bodies, school, relation, affiliated, recording, children, arrange, educat ional, leading, giving, church, carried, volunteering, trough, copyright, nadfas, volunteers, record ers, heritage, widest, promotion, aesthetic, association, europe, promotes, sometimes, benefit, heri tage, societies |
| (SLD : ashridgedfas.org.uk) |
| Regional/Europe/United_Kingdom/England/Hertfordshire/Berkhamsted |
| zum Seitenanfang ↑ |
| Lincoln Lawn Frames |
| Lincoln Lawn Frames |
| http://www.lincolnlawnframes.com/ |
| Offers custom-made metal sign frames and accessories. Includes company profile, product specificatio ns, order information, and testimonials. |
| Lincoln Lawn Framse the #1 affordable and
easy-to-use marketing tool that is changing the look of re al estate. |
| Sign Frames,decorative sign frames,decorative frames for real estate signs,frames for real estate si gns,Outer frames for signs,outer frames for real estate signs,decorative lawn signs, decorative lawn frames,decorative yard signs,decorative yard frames,decorative real estate sign frames,lawn signs,y ard signs,decorative real estate signs, sign posts |
| company, everyone, frames, enhanced, talking, impact, exactly, shopping, status, frames, lincoln, fr iend |
| (SLD : lincolnlawnframes.com) |
| Business/Real_Estate/Marketing_and_Advertising/Signs_and_Displays |
| zum Seitenanfang ↑ |
| Mobius Antiques & Decorative Arts |
| Mobius Antiques & Decorative Arts | Minneapolis |
| http://www.mobiusantiques.com |
| Specializing in the sale of quality Arts and Crafts Period antique furniture and decorative accessor ies, including Stickley and mission furniture, art pottery, lighting, metalware and linens. |
| |
| |
| minneapolis, mobius, antiques, mobiusantiques, street, decorative, jackson |
| (SLD : mobiusantiques.com) |
| Shopping/Antiques_and_Collectibles/Furniture/Post_1900 |
| zum Seitenanfang ↑ |
| RML Decorative Concrete |
| RML Decorative Concrete, LLC |
| http://www.rmldecorativeconcrete.com/ |
| Stamped decorative concrete with unlimited applications, patterns and colors, in the tri-county area . |
| |
| |
| document, getelementbyid, concrete, background, images, sizingmethod, enabled, filter, dximagetransf orm, microsoft, alphaimageloader, progid, slogan, headertop, website, height, decorative, applicatio ns, oldhandler, pngheight, function, concrete, window, onload, commercial, decorative, stamped, cust omers, residential, margin, navcontainer, navtopper, content, topper, apologize, inconvenience, sati sfaction, construction, necessary, provide, association, michigan, knowledge, ensure, certified, ame rican, institute, column, height, rmldecorativeconcrete, members |
| (SLD : rmldecorativeconcrete.com) |
| Regional/North_America/United_States/Michigan/Localities/W/Washington/Business_and_Economy/Construction_and_Maintenance |
| zum Seitenanfang ↑ |
| Le Jardin de la Rose |
| Tole and Decorative Arts Studio Classes,Supplies and Gifts |
| http://www.angelfire.com/ny3/LeJardindelaRose/index.html |
| Offers small tables, boxes, and custom orders. Includes artist profile and links. |
| Learn the art of tole and decorative painting, classes available in beginners,intermidate, and advan ce. Visit our gift shop |
| handpainted, armoires,furniture, hand painted furniture, tole painting, decorative, painting, Middl etown, New York, NY, gifts, armoires,decorative, gifts, wood, arts, crafts, , |
| supplies, studio, decorative, classes |
angelfire.com - rank der domain 1900 (773 in US)
|
| Shopping/Crafts/Supplies/Decorative_Painting |
| zum Seitenanfang ↑ |
| Classic Lines |
| Classic Lines International - French Antique Furniture and Decorative Art |
| http://www.classiclines.biz |
| Specialists in antique furniture and french decorative art. |
| Classic lines International Pty Ltd specialize in the supply of French Provincial Antique and Decora tive Furniture and French Decorative Art |
| classic lines, french, antique, furniture, decorative, art, interior design, french provincial, fren ch style |
| decorative, furniture, ultimate, process, slideshow, selected, international, french, productsantiqu e, classic, antique |
| (SLD : classiclines.biz) |
| Regional/Oceania/Australia/New_South_Wales/Localities/D/Double_Bay/Business_and_Economy/Shopping |
| zum Seitenanfang ↑ |
| My Decorative Flowers |
| Decorative flowers,roses,orchids and bouquets |
| http://www.mydecorativeflowers.com |
| Offering real roses and orchids preserved and encased in assorted glassware. |
| Decorative Flowers,roses and orchids. Real roses,orchids and bouquets preserved in assorted glasswar e. Perfect gift for weddings or table center piece. Now become a distributor! |
| flowers,decorative flowers,roses,orchids,glassware,preserved roses,preserved orchids,my decorative f lowers,deco flowers. |
| flowers, flowers, perfect, candleholders, browse, images, product, category, everything, selection, complete, special, special, glassware, flower, purchases, single, sealed, policies, customer, shippi ng, service, shopping, giftware, exciting, bouquets, orchids, decorative, showroom, occasions, onlin e, stemware, giving, decorative, accept, gladly, beautiful, bright, pieces, center |
| (SLD : mydecorativeflowers.com) |
| Shopping/Flowers/Dried_and_Preserved |
| zum Seitenanfang ↑ |
| Neolam Decorative Laminates |
| Decorative Laminates manufacturer in India. High Pressure Laminate Manufacturer |
| http://www.neolamindia.com/ |
| Producer of decorative laminates for kitchen work top and other interior use. Website includes descr iptions of the products. Located in Gandhara. |
| Producer of decorative laminates for kitchen work top and other interior use. Website includes descr iptions of the products. Located in Gandhara, India |
| decorative laminates, india, high pressure Laminate Manufacturer, decorative laminates india, india decorative laminates, laminates india,decorative laminates,decorative laminates india,high pressure decorative laminates, industrial laminates decorative particle boards, pre-laminated particle boards ,laminate and flooring, laminate cabinet,decorative kitchen cabinet sheets, bath room doors, partiti on sheets,laminate flooring, neolam, neo high laminates, indian sheets, india,_laminate, laminates, hpl, plastic laminates, high pressure laminate, high pressure decorative laminates, high pressure la minates, industrial laminates, paper based decorative laminates, phenolic backer, backer, liner grad e laminate, prelaminated particle board, veneer alternatives, durable surface,decorative panel, swit chboard panels, electrical insulation grade lminate, fire retardent laminate, sandwich grade laminat es, insulated panels, compact laminates, hi screen laminates, durable surface, indian exporters, ind ia |
| manufacturer, inquries, contact, please, laminate, pressure, laminates, decorative, manufacturer |
| (SLD : neolamindia.com) |
| Regional/Asia/India/Haryana/Districts/Rohtak |
| zum Seitenanfang ↑ |
| Lenoir Mirror Company |
| Lenoir Mirror - Factory Direct Framed and Decorative Wall Mirrors |
| http://www.mirrorsmirrors.com/ |
| Retailer of framed, decorative, and wall mirrors. |
| See our factory direct mirrors, framed mirrors, unframed mirrors, decorative mirrors, decorative wal l mirrors, and glass shelf kits. |
| decorative mirrors,decorative wall mirrors,wall mirrors,framed mirrors,unframed mirrors,glass shelf kits,glass shelves,factory direct |
| mirrors, mirrors, decorative, framed, lenoir, decorative, mirror, factory, vacation, direct, company , vacations, direct, carolina, unframed, framed, factory, please, interior, decorator, gallery, asso rtment, colorado, design, enable, javascript, contact, mirror, county, consider, chamber, gideon, en tire, shelving, commerce, frames, caldwell, collection, aremade, blowing, kincaid, street, 8204x250, rights, reserved, resorts, chattanooga, baltimore, maryland, mountains, engine |
| (SLD : mirrorsmirrors.com) |
| Shopping/Home_and_Garden/Accessories/Glass/Mirrors |
| zum Seitenanfang ↑ |
| Paper Mojo |
| Handmade and Decorative Paper from Paper Mojo |
| http://www.papermojo.com/ |
| Wide selection of exotic and decorative papers and supplies. |
| |
| |
| content, script, handmade, decorative |
papermojo.com - rank der domain 902570 (369224 in US)
|
| Shopping/Crafts/Supplies/Paper |
| zum Seitenanfang ↑ |
| Raffi Tokatlian: Mural and Decorative Painting |
| Raffi Tokatlian : Decorative Painting, Decorative Painting Lebanon, Decoration Lebanon |
| http://www.raffitokatlian.com/ |
| Features pictures of previous trompe l’oeil and decorative painting projects. |
| |
| |
| background, repeat, padding, margin, images, decorative, painting, newhome, display, df9450, inline, 857369, decoration, lebanon, tokatlian, d26c4d, height, 271a14, decoration, painting, hotels, galle ry, restaurants, villas, trompe, apartements, private, trompe, normal, sculptures, gallery, vertical , bottom, letter, center, spacing, content, family, db7455, weight |
| (SLD : raffitokatlian.com) |
| Regional/Middle_East/Lebanon/Business_and_Economy/Construction_and_Maintenance |
| zum Seitenanfang ↑ |
| Creative Connectors Corp. |
| Creative Connectors - Wall Shelf, Wall Shelves, Decorative Shelves, Home Shelves, Office Shelves |
| http://www.creativeconnectors.com/ |
| Manufacturer of a invisible mount connecting system used in home decorative shelving, corner and wal l desks. |
| Easy to install decorative shelves and wall shelving: under sink shelves, home entertainment shelves , office shelves, storage shelves, decorative shelves, and more. |
| home decor shelves, home decor shelf, decorative shelving, shelves. |
| shelves, english, office, decorative, creative, connectors |
| (SLD : creativeconnectors.com) |
| Business/Consumer_Goods_and_Services/Home_and_Garden/Storage_and_Shelving |
| zum Seitenanfang ↑ |
| Pacific Crest Industries |
| Home - Decorative Metal | Metal Laminates | Kitchen Backsplashes | Architectural Metal |
| http://www.pacificcrestind.com |
| Manufactures standard and custom handrail and guardrail systems made from stainless steel, aluminum, brass, copper, for architectural and automotive applications. |
| Decorative Metals have been used in Outstanding Decorative Finishes architectural applications for c enturies, designers continue to search for new methods of enhancing their finished appearance. We al so have a new line of kitchen backsplashes and decorative metal laminates for use in industry and ho me. |
| backsplashes, kitchen backsplashes, kitchen backsplash, backsplash, decorative backsplashes, decorat ive backsplash, kitchen murals, stainless steel backsplash, stainless steel backsplashes, decorative metal, decorative metal art, decorative metal fencing, decorative sheet metal, decorative metal fin ishing, decorative metal grate, metal design, sheet metal design, metal building design, metal art d esign, metal truss design, metal gate design, metal furniture designer, chair designer metal, metal designer, de |
| spectrametal, laminates, decorative, appearance, process, backsplashes, kitchen, phenolic, kitchen, patterns, pattern, reflective, backer, document, backsplashes, combining, applications, architectura l, available, finishes, decorative, script, provide, exciting, highly, laminates, finish, colors, re sistant, patinas, stainless, forgot, patterns, column, background, vertically, commercial, engraved, standard, oriented, brushed, coordinate, within, beauty, attractive, images, enhance, single, cover ing, introduces, stainless |
| (SLD : pacificcrestind.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Metals/Metal_Fabrications |
| zum Seitenanfang ↑ |
| Flags on a Stick |
| Decorative Garden Flags | Decorative Outdoor House Flags | Magnetic Mailbox Cover | Flags On A Stick |
| http://www.flagsonastick.com/ |
| Provides a collection of decorative flags, including seasonal, patriotic, theme, sports, and persona lized. |
| Featuring the newest decorative garden flags, elegant decorative flags, and outdoor house flags. Wid e variety of styles. Flags ship FREE with orders over ! |
| Outdoor House Flags,Decorative Flags,Decorative Garden Flags,Magnetic Mailbox Covers |
| summer, garden, mailbox, magnetic, decorative, covers, mailwraps, pagetracker, breezeart, windsocks, toland, displayed, garden, document, mailbox, padding, pagevar, checkout, address, weight, 000000, country, margin, holiday, colorful, display, seasonal, jquery, plaques, location, design, cbaimage, living, visible, transform, gajshost, offset, upfront, select, coordinating, decoration, underline, geraniums, featuring, outdoor, artist, standard, display, windspinners, banners, homepage |
flagsonastick.com - rank der domain 990286 (405649 in US)
|
| Shopping/Home_and_Garden/Flags_and_Banners/Decorative |
| zum Seitenanfang ↑ |
| TweelieCo |
| Custom Wall Clocks Decorative Slate Wall Clocks Decorative Custom Wall Clocks customwallclocks.biz |
| http://www.customwallclocks.biz |
| Decorative custom slate wall designs. Includes return information and privacy policy. |
| Custom Wall Clocks offers decorative slate wall clocks for home or business. Our unique decoratvie custom wall clocks are made from 100% natural slate. With deep earth color mixes and a rustic feel o ur slate wall clocks remind you every day is Earth day. |
| |
| clocks, custom, decorative, document, customwallclocks, function, swapimgrestore |
| (SLD : customwallclocks.biz) |
| Shopping/Home_and_Garden/Accessories/Clocks/Contemporary |
| zum Seitenanfang ↑ |
| Decorative Edison |
| Decorative Edison | Saturday, January 25, 2003 |
| http://dece.comicgenesis.com/ |
| Strip using photographs of people and dogs. |
| |
| |
| january, saturday, decorative, edison |
comicgenesis.com - rank der domain 67401 (28410 in US)
|
| Arts/Comics/Comic_Strips_and_Panels/D |
| zum Seitenanfang ↑ |
| John Canning Painting Studios |
| Decorative Painting | Decorative painting Studios | John Canning Studios |
| http://www.canning-studios.com/ |
| Specializing in ornamental decorative painting, conservation and restoration of historic interiors. |
| |
| |
| canning, preservation, studios, trades, knowledge, generation, traditional, methods, tradition, mate rials, professionals, decorative, decorative, conservation, original, integrity, design, intent, dec orators, excellence, experience, architect, experienced, collaboration, cooperation, within, scholar s, artisans, people, business, fabric, architectural, advocate, coordination, applied, journeyman, p rovides, passing, community, london, guilds, second, tradesman, learning, members, knowledgeable, qu ality, principals, senior, through, organizations |
| (SLD : canning-studios.com) |
| Business/Construction_and_Maintenance/Historic_Preservation/Commercial_Contractors |
| zum Seitenanfang ↑ |
| Notting Hill Decorative Hardware |
| Notting Hill Decorative Hardware offers decorative knobs, pulls, bin pulls, cabinet backplates, and appliance pulls to discerning homeowners, designers and architects seeking high-end, artisan hardware. |
| http://www.nottinghill-usa.com |
| Specially designed knobs and pulls. Can take your concept from art renderings to stunning, dimension al hardware that you'll always treasure. |
| Notting Hill Decorative Hardware creates distinctive, high-end decorative cabinet hardware including decorative knobs, pulls, bin pulls, hinge plates, cabinet backplates, and appliance pulls. |
| Knobs, pulls, backplates, Notting Hill Decorative Hardware, appliance pulls, pewter, brass, gold, an tique brass, antique cabinet pulls, art deco knobs, cabinet knobs and handles, cabinets knobs, cabin et backplates, decorative cabinet hardware, decorative cabinet knob, decorative hardware, decorative kitchen hardware, decorative knobs, flower drawer pulls, knobs for cabinets, Victorian hardware, ru stic knobs |
| notting, decorative, hardware, decorative, cabinet, hardware, designs, macromedia, appliance, backpl ates, proudly, details, beauty, canada, finished, plates, foundry, methods, whether, rustic, victori an, traditional, flower, consider, whimsical, tropical, drawer, prairie, crafts, looking, timeless, throughout, nouveau, available, showrooms, pewter, version, swflash, shockwave, height, download, ho meowners, designers, discerning, offers, architects, seeking, codebase, runcontent, artisan, quality |
| (SLD : nottinghill-usa.com) |
| Shopping/Home_and_Garden/Home_Improvement/Hardware/Decorative |
| zum Seitenanfang ↑ |
| HomeFires |
| Homefires - Decorative English Firebaskets |
| http://www.homefiresusa.com/ |
| Provides decorative English firebaskets. Offers a technology overview, specifications, and a FAQ sec tion. |
| Decorative English Firebaskets, the most realistic gas fires in the world. |
| firebaskets, Homefires, Home fires, Realflame, fireplace, gas coals, decorative firebaskets, gas log s, ceramic, coals, firegrate, fire baskets, fire boxes, vented fireplace, gas fires, hearth, home, d ecorating, interior design, remodel, redecorating, antique, victorian fireplace, AGA, homefiresusa |
| firebaskets, english, decorative, homefires |
| (SLD : homefiresusa.com) |
| Shopping/Home_and_Garden/Climate_Control/Fireplaces |
| zum Seitenanfang ↑ |
| Tole Sampler |
| Tole Decorative Painting Patterns, Decorative Paintings, Decorative Art Paintings from Tole Sampler |
| http://www.tolesampler.com/ |
| Pattern packets designed by Mary Svenson, CDA. Site also offers an art gallery, and art supplies for sale. |
| Tole Sampler is your online source for tole decorative painting patterns, decorative paintings, pain ting instructions, painting designs, art supplies, and painting classes. Creativity thrives from the interaction of creative people. May your life be filled with many hours of happy painting |
| Tole Painting, Decorative Painting, Tole and Decorative Painting, tole decorative painting patterns, tole decoartive paintings, artwork,
painting instructions, paintings designs, painting classes, pa inting packets, paint brushes, art supplies, painted decorations |
| decorative, sampler, painting, autumn, blender, decorative, bouquet, spring, including, treats, clas ses, svenson, welcome, paintings, pattern, paypal, packets, andhelpful, sometime, filled, return, st udio, gallery, westford, buckboard, techfix, design, tolesampler, member, update, recent, convenienc e, samples, pictures, seminars, classes, shopping, strongly, paints, brushes, paintings, supplies, t hrough, gallery, stroll, pointed, patterns, teacher, designer, artist, painting |
| (SLD : tolesampler.com) |
| Shopping/Crafts/Supplies/Decorative_Painting/Patterns |
| zum Seitenanfang ↑ |
| Perma Colour |
| Perma Colour - For All Your Decorative Concrete Needs |
| http://www.permacolour.com.au/ |
| Manufactures and exports products and materials used to make decorative concrete. |
| |
| |
| frames, browser, support, colour, concrete, decorative |
| (SLD : permacolour.com.au) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Concrete/Decorative_Finishes |
| zum Seitenanfang ↑ |
| Decorative Crafts |
| Decorative Crafts, Inc., Importers of Fine Home Furnishings Since 1928 |
| http://www.decorativecrafts.com/ |
| Importers of Italian and Oriental products, with illustrated catalogue. |
| |
| |
| furnishings, decorative, crafts, importers |
| (SLD : decorativecrafts.com) |
| Regional/North_America/United_States/Connecticut/Localities/G/Greenwich/Business_and_Economy/Shopping |
| zum Seitenanfang ↑ |
| Tribu-Design |
| Tribu Design - 20th Century Decorative Art and Design |
| http://www.tribu-design.com/ |
| Decorative arts and design of the 20th century. |
| More than 1000 designers, producers and manufacturers on Tribu-Design : Twentieth Century Furniture, Lighting, Decorative Arts and Industrial Design. |
| design industriel,mobilier,furniture,luminaire,lampe,lamp,lighting,industrial design,tribu design,ch aise,chair,desk,bureau,design,meuble,arts décoratifs,decorative arts |
| design, decorative, century |
tribu-design.com - rank der domain 779566 (24699 in FR)
|
| Arts/Design |
| zum Seitenanfang ↑ |
| Peter Sutton Fitzgibbond |
| Peter Sutton Fitzgibbon Decorative Painting Dublin Ireland |
| http://www.decorativepainting.net/ |
| Decorative and mural painting. Faux, marbling and wood graining paint finishes. Galleries, resume an d contact details. |
| |
| Decorative Painting, Dublin, Ireland, Decorative Painter, Faux Finishes, Trompe L'oeil, Paint Finish es, Paint effects, Specialist Painting, Murals, Marbling, Colorwash, Colourwash, Distressing, Broken Colour |
| dublin, ireland, painting, fitzgibbon, sutton, decorative |
| (SLD : decorativepainting.net) |
| Regional/Europe/Ireland/Dublin/Localities/Kilmainham |
| zum Seitenanfang ↑ |
| Murray Decorative Concrete Supply |
| Murray Decorative Concrete Supply, Inc. - Home |
| http://www.murraydecorative.com |
| Provide decorative concrete products and training in the midwest of the US. |
| Murray Decorative Concrete Supply. |
| stamped concrete,acid stains,decorative overlays,concrete countertops,colored concrete,concrete repa ir,stamping tools,sealers,cures,concrete |
| decorative, concrete, monday, supply, overlay, seminars, contact, sustainability, products, gallery, training, miracote, available, october, supplies, quality, friday, murray, manufacturer, videos, ap proved, provider, thursday, certified, advanced, product, visited, congratulations, reflective, cont inuing, seminars, featured, location, sealer, trainers, certification, experience, representatives, answer, region, company, central, questions, please, contact, office, stamping, education, guideline s, welcome, winter |
murraydecorative.com - rank der domain 986289 (405191 in US)
|
| Business/Construction_and_Maintenance/Materials_and_Supplies/Concrete/Decorative_Finishes |
| zum Seitenanfang ↑ |
| Engrave-A-Crete Inc |
| « Manufacturer of Patented Decorative Grooving and Remodeling Systems for Existing Concrete« Decorative Concrete Engraving Systems | Engrave-A-Crete |
| http://www.e-a-c.com/ |
| Supplier of decorative concrete engraving machines. |
| Start your own decorative concrete engraving business. Engrave-A-Crete has the tools & training you need. No franchise fees required! Engrave-A-Crete | Manufacturer of Decorative Concrete Engraving Sy stems |
| concrete engraving, Engrave-A-Crete, engraveacrete, decorative concrete, engraving concrete equipmen t, concrete engraving systems, concrete business, concrete engraving systems, concrete engraving |
| background, imenus0, concrete, border, scripts, position, height, imsubc, engrave, visibility, repea t, decoration, 000000, business, display, concrete, decorative, hidden, cccc99, visible, object, eng raving, padding, normal, navigator, iactive, version, 660000, systems, existing, perfect, relative, imclear, decorative, mongoose, products, trailer, business, package, staining, document, indexof, do wnload, engraving, margin, existing, absolute, ffffff, training, patented, manufacturer |
| (SLD : e-a-c.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Concrete/Decorative_Finishes |
| zum Seitenanfang ↑ |
| Decorative Laminates Pvt. Ltd. |
| The Decorative Laminates (India) Private Limited |
| http://www.peacockmy.com |
| Manufacturer of Peacock ready-to-assemble furniture including tables, chairs, and sofas. India. |
| |
| |
| private, limited, laminates, decorative |
| (SLD : peacockmy.com) |
| Business/Consumer_Goods_and_Services/Home_and_Garden/Furniture/By_Material/Ready-to-Assemble |
| zum Seitenanfang ↑ |
| UAB ClubBaltica |
| CUSTOM HARDWARE: Door Hardware - Custom door handles, Door Handles, Decorative Hardware |
| http://www.baltica.com |
| European manufacturer of ornate custom door hardware. |
| Custom Hardware: Door Handles Decorative Door Hardware, door handles, Custom Hardware including Door Knobs, Door Knockers, Door Hardware, Decorative Hardware, Cremone Bolts and designer brass and bron ze decorative hardware |
| |
| hardware, handles, decorative, handles, custom, custom, hardware |
| (SLD : baltica.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Doors_and_Windows/Hardware_and_Accessories/Decorative |
| zum Seitenanfang ↑ |
| Brownrigg |
| Antiques UK | Antiques Shop UK | Decorative Antique Furniture | Decorative Antiques shop in London and Petworth |
| http://www.brownrigg-interiors.co.uk/ |
| Offers antique, decorative and contemporary furniture, paintings and sculpture. Profile, services an d product range. |
| Brownrigg Interiors, decorative antiques shop in London and Petworth, UK offers decorative antique f urniture and decorative collectibles like antique ceramics, chairs, sofas, garden furniture, garden antiques, lighting, mirrors, tables, leather goods. |
| antiques uk, anituqes shop uk, decorative antique furniture, decorative antiques shop in London, pet worth, uk, decorative collectibles, antique ceramics, chairs, sofas, garden furniture, garden antiqu es, lighting, mirrors, tables, leather goods, Brownrigg Interiors, West Sussex. |
| antiques, antiques, decorative, document, keyword, frmsearch, function, decorative, furniture, garde n, statues, winname, search, features, theurl, winurl, thewin, london, petworth, french, window, bro wnrigg, furniture, browse, antique, painted, bleached, across, including, spanish, swedish, styles, through, conventional, between, modern, please, search, ecomsolutions, 3399281, urchintracker, submi t, copyright, showrooms, collectible, online, sussex, garden, 321brownrigg, london, brownrigg |
brownrigg-interiors.co.uk - rank der domain 896928 (366737 in US)
|
| Regional/Europe/United_Kingdom/England/West_Sussex/Petworth/Business_and_Economy/Shopping |
| zum Seitenanfang ↑ |
| Black Lab Railings |
| Aluminum Railings for Deck Porch or Decorative from Black Lab Railings |
| http://blacklabrailings.com |
| Provides aluminum railing for deck, porch, or decorative applications. View samples of past projects . |
| Black Lab Railings provides aluminum railings for deck, porch, or decorative applications. Visit ou r website for more information. |
| black lab railings, rhode island, massachusetts, aluminum railings, deck railings, decorative railin gs, porch railings |
| railings, railings, aluminum, address, contactus, company, slatersville, blacklabrailings, please, c ontact, pricing, finished, projects, woonsocket, mailing, street, contact, massachusetts, eastern, a nswer, exterior, decorative, island, aluminum, decorative, servicing, welcome, measure, provide, det ailed, install, railing, little |
| (SLD : blacklabrailings.com) |
| Regional/North_America/United_States/Rhode_Island/Localities/W/Woonsocket/Business_and_Economy/Construction_and_Maintenance |
| zum Seitenanfang ↑ |
| T&C Decorative Painting |
| T & C Decorative Painting |
| http://www.tcdecorative.com/ |
| Offers classes and workshops in faux finishing and stenciling. Includes class schedules and fees. |
| |
| |
| guestbook, decorative, painting, policy, privacy, s11decorative, sitemeter, launched, viewed, greate r, resolution, screen, visitor, website, owners, inside, portfolio, classes, welcome, facebook, upda ted, location, contact, information |
| (SLD : tcdecorative.com) |
| Business/Construction_and_Maintenance/Design/Building_Decorative_Arts/Frescoes,_Murals,_Faux-Finishes |
| zum Seitenanfang ↑ |
| Mosaic Arts |
| Welcome to Mosaic Arts :: Quality decorative mosaics |
| http://www.mosaicarts.co.za/ |
| South African designers and makers of hand cut decorative and architectural mosaic for residential a nd commercial projects in glass, smalti, ceramic and marble. |
| |
| |
| decorative, mosaics, quality, mosaic, welcome |
co.za - rank der domain 11192 (28 in ZA)
|
| Arts/Crafts/Mosaics |
| zum Seitenanfang ↑ |
| Sundek India Ltd. |
| Sundek International - Manufacturer of High Pressure Decorative Laminates |
| http://www.sundekintl.com/ |
| Manufacturer and exporter of high pressure plastic decorative laminates and industrial laminates con forming to British European standards. |
| |
| |
| website, international, sundek, laminate, plywood, laminates, decorative, sunmica, furniture, rights , reserved, copyright, interior, revamped, laminates, customer, decorative, pressure, manufacturer, 9099576767, customercare, sundekintl |
sundekintl.com - rank der domain 975883 (411046 in US)
|
| Business/Construction_and_Maintenance/Materials_and_Supplies/Wood_and_Plastics/Countertops |
| zum Seitenanfang ↑ |
| Decorative Concrete Supply, Inc. |
| DecorativeCS.com - Top Distributor of Decorative Concrete Tools and Supplies |
| http://www.decorativecs.com |
| Texas/Dallas based distributor of Increte Systems decorative concrete and stamped concrete products. |
| |
| |
| concrete, products, decorative, decorative, concrete, confirm, houston, please, carrollton, august, countertop, return, policy, supply, leading, locations, download, powerpoint, reserved, calculator, rights, stamping, september, seminar, seminars, showrooms, pictures, complete, locations, dallas, au stin, prices, competitive, quality, delivered, throughout, supplies, welcome, distributor, decorativ ecs, distributor, supplies, skimstone, proline, defender, marshalltown, abrasive, stegmeier, floorin g, polymer, companies |
| (SLD : decorativecs.com) |
| Regional/North_America/United_States/Texas/Localities/C/Carrollton/Business_and_Economy |
| zum Seitenanfang ↑ |
| Grand Flags |
| Decorative Flags and Banners, Flags of the World, Sports Flags |
| http://www.grandflags.com/ |
| Offers Canadian as well as seasonal flags, banners, and poles. Located in Canada. |
| Decorative flags and banners - American Flags - Us flags of the world - Sports Flags and flagpoles |
| banners and flagpoles,decorative flags,flags and banners,decorative flags and banners,ameican flags, us flags,flags of the world |
| decorative, decorative, sports, garden, international, flying, canadian, mailbox, seasonal, availabl e, brighten, including, covers, banners, seasonal, specials, online, section, closeout, thomas, artw ork, season, fabulous, enjoyment, should, banners, banner, seasons, regularly, kinkade, rotated, hel pful, secure, certificates, destinations, resources, sapphire, website, designers, grandflags, refer rals, privacy, policy, america, national, banner, certificate, outdoor, magnetic, ordering, ontario |
| (SLD : grandflags.com) |
| Shopping/Home_and_Garden/Flags_and_Banners |
| zum Seitenanfang ↑ |
| Heritage Murals |
| heritage mruals - decorative painting |
| http://www.heritagemurals.com/ |
| Decorative painting for house and garden walls, swimming pools and furniture. Includes examples. |
| mural painting - decorative painting for house and garden walls and decorative painted furniture and free info on how to do. |
| mural , painting, house, garden, , exeter, devon, decorative painting, wall painting, painted furnit ure, heritage, interior murals, exterior painting, wall murals, patio painting, garden art |
| murals, heritage, welcome, heritage, mruals, decorative, painting |
| (SLD : heritagemurals.com) |
| Regional/Europe/United_Kingdom/England/Devon/Exeter/Business_and_Economy/Construction_and_Maintenance |
| zum Seitenanfang ↑ |
| Soap Décor Emporium |
| Handcrafted Soap -- Decorative Soap -- Soap Decor Emporium |
| http://www.soapdecoremporium.com/ |
| A selection of handcrafted decorative scented soaps with a feminine theme. |
| Decorative soap, decorative soaps, Quality, handcrafted, delicately scented and lathering glycerin s oaps |
| decorative soap, decorative soaps;hand-crafted soap; scented soap; glycerin soap;hotel toiletries; g ift baskets; unique gifts; fine toiletries; wedding favors; bath and body; molded soap; themed soap; wedding; spa; romantic; homemade soap; lathering glycerin soap; beautiful soap; pretty soaps;soaps. |
| venice, decorative, decorative, wedding, wedding, planning, emporium, handcrafted, unique, creative, superweddings, center, children, career, photos, projects, meaningful, personalized, expert, dorada s, wedding, inspiring, secrets, including, decorating, saving, suggestions, comments, sponsor, spons or, contact, gallery, favors, catalog, ordering, complimentary, benefit, associations, neighborhood, appeared, anniversary, garden, california |
| (SLD : soapdecoremporium.com) |
| Shopping/Crafts/Toiletries/Soaps |
| zum Seitenanfang ↑ |
| Red Lion Stencils |
| Welcome to the World of Decorative Stenciling |
| http://www.redlionstencils.com |
| Theorems and decorative stencils. |
| |
| |
| decorative, stencils, designs, decorative, theorems, stenciling, painters, stencils, photos, paintin g, pagetracker, document, gajshost, challenged, athletes, increases, esteem, enhances, quality, inde pendence, encourages, foundation, believes, supporter, bamboo, florida, magnolia, southern, beautifu l, involvement, sports, instructions, debilitating, marketing, duplication, property, contents, allo wed, graphics, mailing, various, conditions, awareness, creating, promoting, organizations, contagio us, attitudes, infectious, smiles, providing |
| (SLD : redlionstencils.com) |
| Shopping/Crafts/Supplies/Stenciling |
| zum Seitenanfang ↑ |
| The London Decorative Arts Company |
|
| http://www.londondecorativearts.com |
| Provides gilding, mural painting, trompe l'oeil, polished plaster and other decorative paint effects . |
| |
| |
| |
| (SLD : londondecorativearts.com) |
| Regional/Europe/United_Kingdom/England/London/Business_and_Economy/Home_and_Garden/Interior_Design |
| zum Seitenanfang ↑ |
| Jill Macfarlane, Decorative Artist |
| Jill Macfarlane,Decorative Artist |
| http://www.jillmac.com/ |
| JIll Macfarlane displays and sells her decorative painting patterns, books, videos and brushes. |
| Jill Macfarlane, Decorative Artist,displays her art and sells her packets, books, videos and brushes </head> <body background= |
| Decorative Arts, artist, tole painting, paintbrushes,Decorative painting patterns,Microsoft FrontPag e 4.0,mermaid mugs |
| christmas, packets, decorative, national, pattern, macfarlane, contact, holiday, seminar, paypal, pl ease, listed, mermaids, anytime, jmacfar134, damages, society, teaching, painting, conventions, arti st, sketches, pencil, viewing, guarantee, accept, pleasure, account, clicking, billboard, poster, mo nkey, contact, palette, charter, pincher, looking, algebra, murals, japanese, geometry, postcard, in formation, disclaimer, result, limited, extent, consequential, liability, incidental, damages |
| (SLD : jillmac.com) |
| Shopping/Crafts/Supplies/Decorative_Painting |
| zum Seitenanfang ↑ |
| Lamin-Art, Inc. |
| Lamin-Art: premium decorative surfaces for commercial interiors |
| http://www.laminart.com/ |
| Produce a range of decorative laminates for the commercial specification industry of architects and interior designers. Includes product catalog, specifications, and color selectors. |
| Supplier of premium decorative surfacing materials, Lamin-Art specializes in high-pressure decorativ e laminates and high-performance real wood veneers. |
| Decorative plastic laminates, formica, wood veneers, surfacing material, decorative surfaces |
| design, commercial, decorative, pagetracker, document, surfaces, premium, gajshost, innovation, loca tion, coratifs, protocol, rights, reserved, analytics, gettracker, script, 882318, trackpageview, ja vascript, google, 3cscript, unescape, research, leader, develop, pressure, create, english, select, interiors, canada, international, laminates, veloppons, stratifi, pression, recherchons, innovateur, interior, inspire, surface, tements, inspirent |
| (SLD : laminart.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Wall,_Floor_and_Decorative_Finishes/Decorative_Finishes |
| zum Seitenanfang ↑ |
| The Finishing School |
| The Finishing School - Learn Faux and Decorative Painting |
| http://www.thefinishingschool.com/ |
| Information covers classes, workshops, seminars, books, and videos concerning the art and business o f decorative painting, including wood graining, glazing, marbling, and fantasy finishes. |
| The Finishing School - Learn faux and decorative painting at one of the nation's oldest and finest t eaching studies for the art of decorative painting |
| the finishing school, decorative painting, decorative painting new york, decorative painting ny, fau x finishing, faux finishing classes, faux finishing classes NY, faux finishing classes New York, pro fessional painting |
| school, finishing, decorative, professional, teaching, finishes, gallery, schedule, events, support, sophisticated, provide, latest, classes, information, rounded, studios, students, experience, envir onment, products, descriptions, contact, beginners, professionals, student, completing, contracting, operate, locations, offers, stenciling, murals, textured, painted, courses, gilding, venetian, comm issions, curriculum, workshops, development, plaster, business, allows, artistic, tradition, superio r, distributor, design, pcfdesigns |
| (SLD : thefinishingschool.com) |
| Arts/Crafts/Woodcraft/Furniture/Refinishing |
| zum Seitenanfang ↑ |
| RJS Construction |
|
| http://www.rjsconstruction.com/ |
| Block foundations, custom brickwork, fireplaces and decorative stonework, concrete flatwork, decorat ive pavements and basement foundation waterproofing. |
| |
| |
| |
| (SLD : rjsconstruction.com) |
| Regional/North_America/United_States/New_Jersey/Localities/K/Kinnelon/Business_and_Economy |
| zum Seitenanfang ↑ |
| Hoffmann GmbH |
| |
| http://www.artfleur.de/ |
| Germany. Manufacturers of narrow fabrics for technical and decorative applications. Also, decorative textile products and accessories. English and German. |
| |
| |
| |
| (SLD : artfleur.de) |
| Business/Textiles_and_Nonwovens/Textiles/Fabrics/Narrow_Fabrics/Europe |
| zum Seitenanfang ↑ |
| Lori Desormeaux Decorative Arts |
| Lori Desormeaux Decorative Arts |
| http://www.loridesormeaux.com/ |
| Handpainted murals and original glass and tile mosaic work. Decorative finishes of all types, includ ing marbleizing, wood graining and venetian plaster. |
| Fine decorative wall finishes, murals, mosaics, and frescoes for estates, private residences, commer cial and retail spaces, churches and public buildings. |
| finish, mural, mosaic,lori, desormeaux, decorative, arts, faux, paint |
| pagetracker, document, gajshost, geovisit, 3cscript, unescape, location, protocol, gettracker, 98638 65, trackpageview, script, analytics, javascript, google, mosaic, frescoes, mosaics, marbleizing, te xtural, painted, murals, finishes, decorative, desormeaux, specializing, artistic, effects, featurin g, article, inspired, interview, buffalo, treatments, insured, artvoice |
| (SLD : loridesormeaux.com) |
| Arts/Visual_Arts/Painting/Frescoes,_Murals,_Faux-Finishes/Individual_Artists |
| zum Seitenanfang ↑ |
| Teissedre Designs |
| Teissedre Designs - Decorative Tile Southwest |
| http://www.teissedredesigns.com/ |
| Southwest gifts, art and decorative tiles. |
| Teissedre Designs - Decorative Tile and Southwest Decor |
| teissedre designs, Teissedre, decorative ceramic tiles, ceramic tiles, sculpture, animal sculpture, kokopelli, kokopellis, storyteller, storytellers, Cleo Teissedre, pet urn, pet urns |
| southwest, decorative, ceramic, teissedredesigns, designs, teissedre |
| (SLD : teissedredesigns.com) |
| Shopping/Ethnic_and_Regional/North_American/Southwestern |
| zum Seitenanfang ↑ |
| P.J.'s Decorative Stencils |
| P.J.'s Decorative Painting & Stencils, Murals, Stenciling Supplies |
| http://www.pjstencils.com/ |
| Offers stencils, tools, and supplies for custom stencil-cutting. |
| Decorative painting, faux finishes, murals, custom-cut stencils and pre-cut stencils. The best tools for custom stencil-cutting, including E-Z Cut Plastic stencil material,
stencil burners/stencil cu tters, decorative laser-cut stencils, brushes, and faux finish supplies. |
| |
| stencil, stencil, stencils, cutting, painting, flowing, plastic, stencil, decorative, stencils, sect ion, woodgraining, design, gallery, stencils, original, plastic, decorative, stenciling, brushes, st enciling, painting, goddard, cutting, murals, decorative, catalog, special, supplies, limited, studi o, magazines, artistic, techniques, royals, trompe, melanie, stenciler, somerset, action, finish, ai rbrush, country, kitchens, window, dollars, products, supplies, gallery, supplies, transfer |
| (SLD : pjstencils.com) |
| Shopping/Crafts/Supplies/Stenciling |
| zum Seitenanfang ↑ |
| Adela's Functional Art |
| Decorative Cabinet Knobs and Light SwitchPlates by Adela's Functional Art. Decorative Switch Plates, Toile, Custom, Childrens, Kitchen, Country, Animal Themes |
| http://www.adelasfunctionalart.com |
| Manufacturer of cabinet knobs and light switch plates using upholstery fabric and glazing techniques to harden. |
| Beautiful, hand-made cabinet knobs, decorative light switchplates and more switch plates plus toile |
| decorative cabinet knobs, light switchplates, switch plates, children's furniture, toile, decorative hardware |
| decorative, switchplates, cabinet, decorative, functional, switchplate, buttons, hardware, custom, p lates, switch, childrens, kitchen, themes, animal, country |
| (SLD : adelasfunctionalart.com) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Doors_and_Windows/Hardware_and_Accessories/Decorative |
| zum Seitenanfang ↑ |
| Flat Rabbit |
|
| http://www.flatrabbit.net/ |
| Professional color consulting, decorative art, and custom paint treatments for residential projects. |
| |
| |
| denver, licata, colorado, rabbit, consulting, decorative, experience, finishes, decorative, custom, environment, transform, treatments, custom, defaultstatus, painting, window, painter, consultant, pr ofessional |
| (SLD : flatrabbit.net) |
| Regional/North_America/United_States/Colorado/Localities/D/Denver/Business_and_Economy/Home_and_Garden/Interior_Design |
| zum Seitenanfang ↑ |
| Davuka GRP Ltd |
| Coving & Cornice : Decorative Architectural Mouldings |
| http://www.decorative-coving.co.uk/ |
| UK supplier of interior and external decorative architectural mouldings including ceiling coving, co rnice, skirting boards, columns and corbels. |
| Davuka GRP Ltd UK : decorative ceiling coving, cornices, architectural mouldings for trade and retai l. View in 3D. Shop secured by HSBC. |
| coving,cornice,decorative,ceiling,architectural,moulding |
| delivery, service, coving, excellent, cornice, product, coving, excellent, products, axxent, davuka, november, cornice, recommend, ceiling, columns, arrived, pleased, delivered, ceiling, helpful, arch itectural, packed, skirting, before, advice, packaged, prompt, october, received, decorations, compa ny, ordered, definitely, mouldings, placed, corbels, perfect, through, called, condition, people, ef ficient, surrounds, pagetracker, amount, hesitation, speedy, brilliant, quality, decorative |
| (SLD : decorative-coving.co.uk) |
| Business/Construction_and_Maintenance/Materials_and_Supplies/Wall,_Floor_and_Decorative_Finishes/Mouldings |
| zum Seitenanfang ↑ |
| Hummingbird Hill |
| Hummingbird Hill: Decorative Art by Aurelia Conway |
| http://www.hummingbdhill.com |
| Offers several original designs of hand-painted, gourd birdhouses designed by artist Aurelia Conway. |
| Hummingbird Hill: Decorative Painting and Patterns by Aurelia Conway |
| hummingbird hill, tole painting, toll painting, gourd, nsdp, sdp, national society of decorative pai nters, society of decorative painters, decorative painting , decorative, painted, art, folk art, fab ric painting, vest, patterns, wood, pattern packet, snowmen, bunny, halloween, christmas, gourds, de corative painting |
| aurelia, decorative, gourds, patterns, society, painting, garden, gourds, hummingbird, painters, inf ormation, birdhouses, including, garden, enterprises, chapter, painting, member, teaching, intermedi ate, beginner, taught, indiana, convention, conway, annual, memory, knowledge, teacher, jersey, flor ida, awaken, extrav, convention, conventions, retreats, seminars, expand, creatively, former, school , understood, internationally, nationally, creative, subverbis, importance, skills, experienced, ins piring, painter |
| (SLD : hummingbdhill.com) |
| Shopping/Home_and_Garden/Garden_Accessories/Birdhouses,_Feeders,_and_Baths/Decorative_Birdhouses |
| zum Seitenanfang ↑ |
| Decorative Painting Guide from Better Homes and Gardens |
| Decorative Painting - BHG.com |
| http://www.bhg.com/decorating/paint/decorative-painting/ |
| Offers tips on decorative painting techniques, with step-by-step tutorials. |
| Master faux finishes, murals, and glaze projects with our easy how-to guides. |
| |
| decorating, painting, document, better, infomodscroll, decorative, projects, gardens, relatedinfomod content, addevent, function, service, vidtab, addthis, setstyle, display, element, indexof, navigato r, useragent, painted, plaster, finish, subscription, topics, stenciling, treatments, wallpaper, new sletters, subscribe, techniques, network, holidays, arrange, colors, bedroom, furniture, window, add ress, community, receive, gallery, magazine, scrollback, return, scrollforward, scrolllinks, forward , relateditemsarr, cookbook, scrollknob |
bhg.com - rank der domain 2822 (1104 in US)
|
| Home/Home_Improvement/Painting/Specialized_Techniques |
| zum Seitenanfang ↑ |
| Prismatic Painting Studio |
| Faux and Decorative Painting Courses and Supplies |
| http://www.prismaticpainting.com/ |
| Offers books and instructional videos for a variety of painting techniques. Includes excerpts from b ooks, and information on classes. |
| Faux painting supplies, tools, and instructional materials are available from Prismatic Painting Stu dio. A broad range of classes are offered. |
| faux painting, faux, faux finishing, faux techniques, faux painting class, faux painting course, dec orative painting, decorative, painting, Prismatic Painting Studio, Prismatic, studio, decorative wal l finish, tromp l'oile, workshops, books, videos, technique, gallery, Cincinnati, faux painting clas ses, instruction, class, decorative painting class |
| 00346f, weight, background, visited, supplies, courses, decorative, painting |
| (SLD : prismaticpainting.com) |
| Shopping/Home_and_Garden/Home_Improvement/Paint_and_Sundries |
| zum Seitenanfang ↑ |
| Blaine, Melissa |
| Melissa Blaine's Decorative Painting Gallery |
| http://ssor.net/Blaine/ |
| Decorative art paintings in acrylic on various objects, such as chip-wood boxes and wooden plaques. |
| The Art of Melissa Blaine |
| decorative painting, painting, folk art, acrylic, angels, chip-wood boxes, placks, design, art, patt erns, brush, strokes, stipling |
| screen, melissa, internet, explorer, netscape, change, switch, standard, browser, welcome, gallery, painting, blaine, decorative, browsing, keyboard |
| (SLD : ssor.net) |
| Arts/Visual_Arts/Personal_Pages/B |
| zum Seitenanfang ↑ |
| Windspirits |
| WindSpirits - Decorative Flags |
| http://www.windspirits.com/ |
| Presents Windsport decorative and garden flags, wind socks, and banners. |
| |
| decorative flags, flags, garden flags, ganz, windsox, miniflags, house flags, flag.com, wind banners , wind socks Flags, Ganz, Windsport, 3-D scupltures, |
| browser, location, frames, support, document, decorative, cookie, referurlr, escape, windspirits, re ferrer |
| (SLD : windspirits.com) |
| Shopping/Home_and_Garden/Flags_and_Banners/Decorative |
| zum Seitenanfang ↑ |
| Caromtex Decor SRL |
| Amenajari gradini spatii verzi - Borduri decorative curbe bordura dreapta - Mobilier Gradina - Plante decorative - CaRomTex Decor |
| http://www.caromtex.net |
| Oferă borduri decorative continue pentru amenajarea grădinii şi a spaţiilor verzi. |
| CaRomTex Decor ofera amenajare gradina, spatii verzi, borduri decorative curbe sau drepte, plante de corative, irigatii gradina, mobilier gradina |
| bordura,borduri decorative,borduri,caromtex decor,amenajari gradina,spatii verzi,mobilier gradina,pr oiectare peisagistica,plantari,intretinere spatii verzi,consultanta achizitionare plante,arboricultu ra ornamentala,floricultura ornamentala,plante decorative,irigatii gradina |
| decorative, mobilier, gradina, plante, caromtex, dreapta, gradini, amenajari, spatii, borduri, bordu ra |
| (SLD : caromtex.net) |
| World/Română/Afaceri/Servicii_şi_bunuri_de_larg_consum/Casă_şi_grădină |
| zum Seitenanfang ↑ |
| Sofa Garden |
| Decorative Pillows by Sofa Garden |
| http://www.sofagarden.com/ |
| Designer and manufacturer of uniquely shaped decorative pillows for the home, office and individual. |
| Sofa Garden is an online decorative pillow boutique where you can expect the unexpected. Every pillo w on the site is designed and manufactured by Sofa Garden in the USA. |
| decorative pillow, throw pillow, accent pillow, toss pillow, designer pillow, decorator pillow |
| garden, martini, coffee, treats, scribbles, indigo, privacy, swerve, glasses, collections, longtime, favorites, copyright, reserved, rights, 345339, geovisit, urchintracker, returns, shipping, contact , suspects, inspired, dragonfly, swirls, patchwork, pillows, decorative, celestial, crescent, veliar ca, unusual, rustic, introducing, cigars, stripes, hearts, modern, alchemy |
| (SLD : sofagarden.com) |
| Shopping/Home_and_Garden/Soft_Furnishings/Cushions_and_Decorative_Pillows |
| zum Seitenanfang ↑ |
| Decorative Mirrors |
| Decorative Mirrors, Victorian Mirrors and Custom Mirrors |
| http://www.williamscabinetry.com/ |
| Offers Victorian and traditional wood framed mirrors. |
| Manufacturers of decorative mirrors, chalkboards and shelves. Including both traditional and Victori an mirrors |
| decorative mirrors,decorative mirror,wall mirror,wall mirrors,beveled mirror,victorian mirror,victor ian furniture,shelves, chalkboard, home decor, home furnishings, bathroom fittings, decorating |
| mirrors, mirror, cabinetry, williams, mirrors, higher, victorian, rights, accessories, shelves, qual ity, decorative, framed, beveled, version, follows, internet, explorer, shipment, navigator, chalkbo ards, netscape, immediate, viewed, contact, craftsmanship, wholesale, tradition, retail, mirrors, un registered, trademarks, referenced, registered, reserved, incorporated, herein, property, trademark, claimed, owners, respective, webmaster, resolution, screen, recommended, please, contact, concernin g, comments, problems |
| (SLD : williamscabinetry.com) |
| Shopping/Home_and_Garden/Accessories/Glass/Mirrors |
| zum Seitenanfang ↑ |
| Verre Actuel |
| Verre Verre Actuel: glass shop, decorative glassmakers, Montreal. |
| http://www.verreactuel.com/indexA.htm |
| Specializes in design, manufacture and sales of decorative and structural glass and stained glass pr oducts, including mirrors and pieces of furniture. |
| Specializing in decorative and structural glass and stained glass for nearly 30 years we design, man ufacture and retail mirrors, pieces of furniture.. |
| glass, stained glass, mirrors, glass tables, glass furniture, stained-glass fabrication, sand-blaste d glass, bevelled glass, glass partitions, structural glass, decorative glass, montreal, quebec, scu lpted glass panel, thermoformed glass decorations, decorative glass panels, tempered Glass, moulded glass, thermoformed Glass, painted glass, shivered Glass, melted glass, exclusive glass furniture, |
| passez, montreal, decorative, actuel, glassmakers |
| (SLD : verreactuel.com) |
| Regional/North_America/Canada/Quebec/Localities/B/Boisbriand |
| zum Seitenanfang ↑ |
| Garden Flags |
| Decorative Garden Flags for your House and Yard |
| http://www.garden-flags.com/ |
| Garden flags, yard flags, patio furniture and decorative items for your home included. |
| Decorative garden flags for your home, yard and mailbox. |
| garden flags,mini flags,christmas flags,decorative flags,toland,flag,patriotic,valentine flags,yard flags,college flags,mailbox flags,thanksgiving flags |
| garden, garden, selection, virginia, available, decorative, college, decorative, category, holiday, season, individual, mother, father, summer, patriotic, buying, popular, spring, shopping, brought, p opular, hanukkah, christmas, halloween, thanksgiving, include, appliqu, designs, artist, barbara, au gello, patrick, clicking, variety, valentine, estate, colleges, spirit, fingerz, gloves, monogram, o pened, spinners, windsocks, accessories, favorites, clearance, bargains, patriotic, mailbox |
garden-flags.com - rank der domain 991269 (406058 in US)
|
| Regional/North_America/United_States/Virginia/Localities/L/Lynchburg/Business_and_Economy/Home_and_Garden |
| zum Seitenanfang ↑ |
| Decorative Center |
| Decorative Center Houston |
| http://decorativecenter.com/ |
| Source for customized interior furnishings and accessories. |
| |
| |
| margin, version, latest, pagetracker, document, gajshost, player, height, google, analytics, 3cscrip t, unescape, protocol, location, 8517004, trackpageview, gettracker, center, javascript, script, dec orative, houston, bottom, helvetica, content, 1000px, website, requires, please, download, backgroun d, padding, verdana, f2f2f2 |
| (SLD : decorativecenter.com) |
| Regional/North_America/United_States/Texas/Localities/H/Houston/Business_and_Economy/Home_and_Garden |
| zum Seitenanfang ↑ |
| Heisinger Design |
| Heisinger Design - Architectural & Decorative Mosaics |
| http://www.heisingerdesign.com |
| Decorative and architectural stained glass mosaics. Fine art pieces and commissions are featured. |
| |
| chris, heisinger, design, architectural, decorative, mosaics, stained, glass, chicago, illinois, eva nston |
| decorative, mosaics, architectural, heisinger, design |
| (SLD : heisingerdesign.com) |
| Arts/Crafts/Mosaics/Glass |
| zum Seitenanfang ↑ |
| Greenland Shutters |
| Window Shutters | Exterior Shutters | External Shutters | Plastic Shutters | Decorative Shutters |
| http://www.window-shutters.co.uk/ |
| Maintenance free vinyl in louvered, lasalle, and expandable, choice of 9 colors. UK based. |
| UK Manufacturers and nationwide suppliers of maintenance free UPVC exterior window shutters for the home. Shop Online. Lowest UK prices for window shutters, exterior shutters, plastic shutters, extern al shutters and decorative shutters. |
| uk exterior decorative window shutters plastic, exterior shutters, window shutters, plastic shutters , decorative shutters, external shutters |
| shutters, shutters, simply, exterior, decorative, window, window, enlarge, maintenance, shutter, pla stic, exterior, little, installed, external, character, colour, plastic, external, synthetic, decora tive, variety, hardwood, painting, sitemap, country, enhancing, website, replacement, associated, co ntact, production, product, georgian, effective, articles, feature, discover, option, moulded, weath er, louvre, traditional, preferred, different, colours, windows, choose, manufactured, overall, incr easing |
| (SLD : window-shutters.co.uk) |
| Shopping/Home_and_Garden/Windows/Window_Coverings/Shutters |
| zum Seitenanfang ↑ |
| Tapestry Garden Flags |
| Decorative Garden Flags and House Flags from Tapestry Gardens |
| http://www.tapestry-garden-flags.com |
| Offers decorative flags and garden flags in styles for holidays, seasons and everyday. |
| Your source for decorative garden flags and house flags in applique and art styles |
| garden flags, house flags, decorative flags, applique flags, christmas flags, easter flags, mini fla gs, flags, yard flags, inspirational flags, evergreen flags, toland flags, memorial flags |
| applique, garden, garden, evergreen, fabric, decorative, premier, gardens, creative, polyester, avai lable, tapestry, quality, impressions, weather, toland, process, lasting, resistant, flying, finest, highlighted, detail, different, styles, colorful, stitching, conditions, accent, brilliance, decora tive, halloween, christmas, design, nationally, dimensional, embroidery, results, called, transfer, printed, pollutants, recommend, create, detergent, shoots, washing, through, sublimation, special, r eserve |
| (SLD : tapestry-garden-flags.com) |
| Shopping/Home_and_Garden/Flags_and_Banners/Decorative |
| zum Seitenanfang ↑ |
| Phoenix Art Supply |
| Phoenix Art Supply - Handmade, Imported & Decorative Paper |
| http://www.phoenixartsupply.com/ |
| Offers decorative and handmade papers and art supplies |
| Phoenix Art Supply offers a large assortment of decorative paper, handmade paper and imported paper. |
| paper, decorative, papers, art, scrapbook, supply, phoenix, imported, stamp, cardmaking, supplies, Phoenix Art Supply |
| phoenix, decorative, supply, decorative, project, imported, offers, scrapbook, papers, papers, desig n, stationery, accents, scrapbook, package, supplies, decoupage, making, screens, reserved, rights, designed, animation, graphics, wingard, copyright, contact, projects, resources, privacy, collage, s pecials, metallic, textures, colors, selection, weights, perfect, possible, assortment, imported, ha ndmade, handmade, imagine, creative, notice, designs, lampshade, cardmaking, parchment, calligraphy |
| (SLD : phoenixartsupply.com) |
| Shopping/Crafts/Supplies/Paper |
| zum Seitenanfang ↑ |
|
Sitemap.XML / Sitemap.HTML / search / Kontakt & Impressum / Domains
