| EzForecaster |
| Business forecasting, Demand planning, Inventory planning, Sales and operations planning, Sales forecasting software and services |
| http://www.ezforecaster.com |
| A business forecasting add-in for Microsoft Excel. |
| Fast, accurate, affordable and easy-to-use business forecasting, demand planning, inventory planning , sale & operations planning, supply chain planning, and demand forecasting software solutio ns for sales forecasting. Forecasting for dummies. ezForecaster can improve any company’s Supply Chain Management, S&OP, and ERP process. |
| business forecasting, demand planning, inventory planning, forecasting for dummies, S&OP, sales and operations planning, supply chain planning, sales forecasting, forecasting software, forecasting pro cess, supply chain, demand forecasting, business forecasting, collaborative forecasting, supply cha in management, demand management, processes, business, services, forecasting, &, collaborati ve, chain, demand, planning, supply, collaborative planning |
| ezforecaster, compete, document, forecasting, planning, bootstrap, forecast, getelementsbytagname, m inutes, chainsaw, overpriced, oversized, charges, microsoft, inside, cutting, downloading, offerings , butter, already, maintenance, access, applications, business, immediacy, accuracy, companies, simp licity, prefer, forget, protocol, location, javascript, script, createelement, operations, inventory , demand, business, software, services, function, df6917d3436b2f1fd2ebd641841f5b80, appendchild, bef ore, compare, implementations, lengthy, upfront, trying, thousands |
| (SLD : ezforecaster.com) |
|
| zum Seitenanfang ↑ |
| C2 Estimator |
| C2E.com |
| http://www.c2e.com |
| Construction add-on to Excel for quantity surveying or cost estimating. Free download. |
| |
| |
| industry, software, client, construction, projectman, newest, currently, solution, create, register, online, necessary, chooser, projectman, choose, products, estimator, weekly, reports, useful, parti cipants, funded, learnt, confusion, weekly, report, writer, informed, copyright, available, australi a, within, download, contracts, identify, unavailable, improved, easier, currently, mission, bidders , ensure, estimating, choose, builders, australian, product, preview, collaboration, competitor, con tracts |
| (SLD : c2e.com) |
|
| zum Seitenanfang ↑ |
| Excel Password Remover |
| Excel password remover |
| http://www.elkraft.ntnu.no/~huse/xlpassword.htm |
| Add-in that removes passwords, with certain limits. Postcard-ware. |
| Free password recovery software for excel. Removes sheet and workbook protection. Crack,
ha ck, remove password protection |
| excel, password, crack, remove, recover, recovery, office, word, winword, outlook,
access, msword, lotus, 1-2-3, organizer, lost, forgotten, download, free, software, development, security, privacy, cryptography,
protection, tools, 97, 2000, 7.0, 8.0 |
| remover, password |
ntnu.no - rank der domain 27733 (70 in NO)
|
|
| zum Seitenanfang ↑ |
| Computers/Software/Spreadsheets/Excel/Add-Ins |
|
|
| Computers/Software/Spreadsheets/Excel/Add-Ins |
| zum Seitenanfang ↑ |
| Decision Models' FastExcel |
| FastExcel Customers and Comments - Decision Models |
| http://www.decisionmodels.com/fastexcel.htm |
| Professional spreadsheet consultant has developed FastExcel to help run Spreadsheets quicker. FastEx cel provides analysis and helpful solutions to potential spreadsheet problems. |
| When Excel spreadsheets are slow,FastExcel Helps you speed up Excel by eliminating slow bottlenecks and problems |
| Excel slow response, calculation bottlenecks, Fast Excel, Speed up Excel, Excel memory limits, Large spreadsheet problems, not enough memory, excel calculation efficiency, calculation limits, large, f ast, slow, limits |
| fastexcel, university, australia, customers, spreadsheet, suisse, credit, calculation, recommended, itself, america, highly, global, services, optimizing, international, capital, sprint, morgan, absol ute, position, height, montreal, models, decision, dennis, comments, sikorsky, zurich, complicated, restructuring, extremely, suggestion, nyhagen, struggling, rename, inherited, worksheets, planning, financial, finished, engineer, enough, transport, comments, change, through, within, moments, sugges ted, installing |
decisionmodels.com - rank der domain 955102 (29692 in GB)
|
|
| zum Seitenanfang ↑ |
| SQL*XL Links Excel to Oracle |
| SQL*XL: Oracle to Excel bridge. Brings Database access native into Excel. |
| http://www.oraxcel.com |
| Adds a menu item to Excel through which SQL can be submitted to Oracle. Full featured and allows bul k inserts/updates, PL/SQL, VBA. |
| Retrieve, manipulate and update Oracle or other external data from MS Excel. Database data can be in serted easially from Excel spreadsheets. Loading data into Excel was never easier. Full VBA support. |
| excel,oracle,software,link,connectivity,intuitive,data,
dbms,rdbms,alternative,simple,development,a dd-in,microsoft,SQL*XL,sqlxl,sql xl,ora,xl,ora xl,ddl,dml,vba,query,sql,builder,querybuilder,
8i,8. 0.5,7.3.4,7.1,7.1,pl/sql,excel add-in,excel add-ins,query builder,oracle dbms,oracle rdms,sql builde r,
data retrieval,retrieval,database software,databases,database,oracle database,microsoft excel,of fice,microsoft office,
pdf,csv,odbc,oledb,ole db,ado,sql server |
| padding, padding, margin, bottom, litlib, bottom, release, boards, margin, encoffice, oracle, softwa re, linker, topbalk, decoration, database, bridge, products, corporation, registered, performance, t rademarks, warranties, vector, functions, vertical, excellock, products, forums, contact, background , windows, network, client, commands, litsoftware, weight, twitter, forums, symmetry, windows, mspro ject, mathematica, basics, datarange, weblog, extend, dawkins, startup, directory, copyright |
oraxcel.com - rank der domain 825457 (26008 in GB)
|
|
| zum Seitenanfang ↑ |
| Spinnaker Software Solutions |
| Custom Excel Macros and Add-ins by Spinnaker |
| http://www.spinnakeradd-ins.com |
| Add-ins for Microsoft Excel. Downloadable shareware and freeware: Spinnaker Screens, Alerts, Strings , Functions, Merges, Columns, Extracts, Passwords, Fuel Tax Program, Image Wizard, Statistics and Pr ints. |
| We develop Custom Excel Macros and Add-ins for Microsoft Office applications. We also offer Freeware and Shareware Excel Add-ins that can be downloaded from our site. |
| Excel, Add-ins, addins, macro, Freeware, Shareware, Spreadsheet, Screen, Column, Filter, String, Mer ge, Functions, Extract, Print, Microsoft, Office, addin, downloads, Hodrick, Prescott, Graph, Alert, Fuel Tax, Password, Query |
| visual, office, getinfo, custom, spinnakeradd, microsoft, custom, developed, information, program, v ersion, latest, please, suggestions, message, messaging, macros, spinnaker, program, frames, floatin g, industry, solution, programming, shareware, transportation, critical, values, paging, available, spreadsheet, choice, execute, register, 1603981, urchintracker, please, address, hessel, partners, p arise, telephone, calling, postal, background, features, examples, targeted, spreadsheets, towards, fulfill |
| (SLD : spinnakeradd-ins.com) |
|
| zum Seitenanfang ↑ |
| ASAP Free Utilities |
| ASAP Utilities - The essential add-in for Excel users. FREE excel tools and macros to save time. Download Excel tools - Excel software |
| http://www.asaputilities.nl |
| Excel add-in contains over 300 utilities to fill the gaps in Excel, and automate frequently used tas ks. |
| ASAP Utilities is a powerful Excel time saving add-in that fills the gaps in Excel and automates fre quently used tasks. Since 1999 it has grown to become probably one of the world's most popular softw are add-ins for MS Excel 97, 2000, 2002/XP, 2003, 2007 and 2010 with over 300 macros. |
| asap utilities excel macro add-in software download free, asap, essential addin office excel, excel tools, excel add-in, excel addin, excel addins, excel utilities, excel macro, free excel, excel 97 2 000 2002 XP 2003 2007 2010, asap utilities excel programs software, excel add in, free excel add-ins , excel asap, asap-utilities, asap utility, utilties software tutorial guide documentation help down load macros utiities add-on utilites addon productivity tools spreadsheet software essential, utilit es |
| download, software, weblog, contact, search, essential, utilities, macros |
| (SLD : asaputilities.nl) |
|
| zum Seitenanfang ↑ |
| Frontline Systems |
| Excel Solver, Optimization Software, Monte Carlo Simulation - Frontline Systems |
| http://www.solver.com/ |
| The company that developed the basic solver offers the Premium Solver. Provides download, online ord ering, company information and a tutorial. |
| Download Excel Solver upgrades and Solver SDK for linear programming, nonlinear optimization, geneti c and evolutionary algorithms, global optimization, and simulation optimization in Excel, Visual Bas ic, VB.NET, C#, C++, Java and MATLAB |
| excel solver downloads, simulation optimization, excel solver, optimization software, optimization, solver, Excel, Visual Basic, VB.NET, C#, C++, Java, MATLAB, linear programming, genetic algorithm, g lobal optimization |
| solver, products, platform, support, optimization, optimization, programming, premium, simulation, s imulation, frontline, upgrades, systems, developers, upgrade, assistance, clicktale, matlab, consult ing, address, licenses, product, document, google, pagetracker, gajshost, distribution, privacy, exa mple, support, register, obligation, please, select, methods, models, powerful, consulting, software , products, whenever, versions, download, papers, instant, access, guides, university, protocol, loc ation, unescape |
solver.com - rank der domain 251501 (107106 in US)
|
|
| zum Seitenanfang ↑ |
| Computers/Software/Spreadsheets/Excel/Add-Ins |
|
|
| Computers/Software/Spreadsheets/Excel/Add-Ins |
| zum Seitenanfang ↑ |
| ExcelEverywhere |
| Convert Excel into live and calculating web pages - SpreadsheetConverter |
| http://www.exceleverywhere.com |
| Converts a spreadsheet to an HTML page with formulas translated to javascript. Provides a FAQ, onlin e ordering and company information. |
| SpreadsheetConverter lets you publish spreadsheets and charts on the web. Change any cell and the on line spreadsheet or live chart immediately updates itself. Put your booking and order forms on the w eb and have them sent directly to your inbox. Create powerful dynamic charts for your blog. |
| spreadsheetconverter,excel,spreadsheet,faq |
| support, generate, twitter, released, charts, contact, models, converted, included, server, driven, customer, support, required, dynamic, versions, needed, browser, follow, questions, customer, presal e, center, examples, version, products, download, spreadsheetconverter, calculating, convert, newsle tter, thanks, supports, exactly, single, product, completely, complete |
exceleverywhere.com - rank der domain 918451 (324937 in US)
|
|
| zum Seitenanfang ↑ |
| Navigator Utilities |
| |
| http://www.robbo.com.au |
| Eases navigating through complex spreadsheets. Provides company and purchasing information, free dem o and a presentation of the product. |
| |
| |
| |
| (SLD : robbo.com.au) |
|
| zum Seitenanfang ↑ |
| DJI Computer Solutions |
| DJI Computer Solutions - Golf Handicap & Statistics, Checkbook, Scheduling & Tax Software for Microsoft Excel and Palm |
| http://www.djicomputer.com |
| Proposes applications for personal finances, golf, scheduling, tax calculations and task management. |
| DJI Computer Solutions - Golf Handicap, Checkbook, Golf Statistics, Project Management, Tax and Sche duling Software Applications for Microsoft Excel and Palm OS. |
| Golf Handicap, Excel Software, Spreadsheet Software, Software, Golf Handicap Software, Golf Software , Golf Statistics Software, Handicap Software, Checkbook Software, Checking Software, Banking Softw are, Personal Finance Software, Project, Project Manager, Project Management Software, Gantt Chart, Task Manager, Tax Forms, Tax Software, Schedule, Scheduling Software, Programming, Golf Tips, Data I mport, Database Import, Excel Import, Taxes, Palm Software, Excel, Excel Applications, Palm Applicat ions, Excel Add-ons, QIF, Paypal |
| handicap, manager, software, microsoft, computer, solutions, release, software, program, released, v ersion, available, download, checkbook, register, compliant, report, updates, allows, robust, system , addition, scoring, enhancements, functionality, season, current, individual, improve, statistics, golfers, leagues, handicaps, scores, reporting, features, enhanced, version, provides, golfer, every thing, matches, online, importing, course, calculator, assistant, scheduler, support, privacy, stati stics |
djicomputer.com - rank der domain 980819 (377869 in US)
|
|
| zum Seitenanfang ↑ |
| Lumenaut |
| Monte Carlo Risk Simulation, Decision Tree, Statistical
Analysis Add-in Software for Excel by Lumenaut |
| http://www.lumenaut.com |
| Monte Carlo, Decision Tree and Statistics add-in for risk analysis |
| Monte Carlo risk simulation, decision analysis, and statistics software. Avoid uncertainty and make optimum decisions. |
| risk analysis, risk analysis software, risk assessment tool, risk modeling, modeling, simulation, Mo nte Carlo simulation, Monte Carlo Analysis, Excel add-in, Six Sigma, financial, investment, uncertai nty, variability modeling, distribution functions, sensitivity analysis, scenario analysis, stress a nalysis, Decision Tree, Decision Trees, decision support, quantitative decision analysis, decision m aking under uncertainty, decision tree software, decision making software, what-if analysis, time-se ries forecasting, statistical analysis, histograms, tornado charts, scatter plots, lumenaut, lumenat , lumnaut, lunenaut |
| software, lumenaut, statistical, simulation, decision, analysis |
| (SLD : lumenaut.com) |
|
| zum Seitenanfang ↑ |
| World Clock |
| Excel World Clock |
| http://kenmzoka.tripod.com/cgi-bin/ExcelWorldClockUK.htm |
| File shows the local times in the USA, the UK and Japan relative to GMT and 4 different time zones, including Los Angeles, Ohio and Europe (GMT+1). |
| Excel is used to show the local times
in the USA and Japan relative to the time in the UK (GMT) |
| Excel World Clock UK GMT Time Difference International Dialing Code Euro Currency Conversion |
| height, background, social, images, position, repeat, important, window, search, container, margin, document, button, padding, display, jquery, tripod, category, sunday, relative, section, decoration, function, onbutton, documentelement, adbanner, sprite, january, summer, center, return, setforcedpa ram, normal, clientwidth, animate, clientheight, onsearch, onshare, hidden, contain, member, countri es, february, hosted, family, helvetica, replace, underline, absolute, pointer, cursor |
tripod.com - rank der domain 857 (45 in JP)
|
|
| zum Seitenanfang ↑ |
| XLCubed |
| XLCubed Solutions |
| http://www.xlcubed.com |
| Provides access to SQL Server Analysis Services to manipulate business data directly in a spreadshee t. Presentation of the company and its technology. In the UK. |
| XLCubed Solutions. |
| |
| xlcubed, solutions, please, within, seconds, limited, trademarks, acknowledged, inconvenience, xlcub ed, window, location, redirected |
xlcubed.com - rank der domain 906752 (61974 in DE)
|
|
| zum Seitenanfang ↑ |
| DealMaven |
| FactSet Research Systems Inc.
:
FactSet Research Systems |
| http://www.dealmaven.com |
| Provides tools to gather, analyze, check and present quantitative data. Presentation of the company and its products and FAQs. |
| FactSet (NYSE: FDS) is a leading provider of global financial and economic information, including fu ndamental financial data on tens of thousands of companies worldwide. Combining hundreds of database s into its own dedicated online service, FactSet also provides the tools to download, combine, and m anipulate financial data for investment analysis. |
| "asset allocation advice", factset research systems |
| factset, research, systems, swcontrol, swversion, weight, height, helvetica, family, decoration, imp ortant, equity, workflow, display, careers, topnav, insight, background, investment, quarter, visibi lity, transcripts, shockwaveflash, events, portfolio, function, vbgetswfver, investment, market, ccc ccc, analytics, vertical, mainnav, visible, performance, integrated, support, bankers, product, indu stry, managers, company, designed, analyze, analysis, alternative, customized, platform, strategies, exposure, predicted |
| (SLD : dealmaven.com) |
|
| zum Seitenanfang ↑ |
| XMLtoXLS |
|
| http://www.forgram.com |
| Allows XML data to be imported into Excel. |
| |
| |
| |
forgram.com - rank der domain 993857 (430708 in US)
|
|
| zum Seitenanfang ↑ |
| Spreadsheet Professional - Professional spreadsheet development tools |
| Home Page |
| http://www.spreadsheetinnovations.com |
| Provides development tools for building, testing, documenting and using spreadsheets. Presentation o f the company and its product, contact and purchasing information. In the UK. |
| |
| spreadsheet innovations,financial model, spreadsheet test, spreadsheet testing, model testing, sprea dsheet professional,spreadsheet,spreadsheets,spreadsheet model,spreadsheet audit,spreadsheet tools, errors,spreadsheet errors,accountants,accountancy |
| spreadsheet, spreadsheet, professional, product, national, models, errors, citibank, scottish, sarba nes, versions, designed, produce, quality, spreadsheets, organisations, download, description, testi ng, accountancy, providing, mercer, services, central, trillium, billiton, paribas, commercial, fort is, alfred, intesa, ireland, revenue, barclays, manhatten, mutual, cearns, warburgs, bahrain, rumeli , office, telekom, bechtel, zealand, inland, munichre, prudential, product, support, itself, dramati cally |
| (SLD : spreadsheetinnovations.com) |
|
| zum Seitenanfang ↑ |
| A3 Solutions |
| A3 Solutions: Corporate Efficiency and Spreadsheet Budgeting Software Experts |
| http://www.a3solutions.com/ |
| Solutions for forecasting, budgeting and management reporting. Located in San Franciscon, CA, USA. |
| A3 Solutions uses OLAP tools and business intelligence reporting tools to maximize productivity. Bud get management software thrives on our Spreadsheet Automation Server. |
| Financial Performance Management, Kpi Measurement Tools, Key Performance Indicators, Capital Budgeti ng Software, Budget Management Software, Business Intelligence Olap, Business Budgeting Software, Bu siness Intelligence Reports, Management Reporting, Intelligence Dashboard, Financial Consolidation, Financial Budgeting, Olap Consulting, Hyperion Software, Hyperion capital, Corporate Budgeting, Olap Reporting, Business Intelligence, Budget Worksheet, Performance Management, Hyperion Essbase, Sprea dsheet Applications, Executive Dashboard, Olap Tools |
| budgeting, software, experts, spreadsheet, efficiency, solutions, corporate |
| (SLD : a3solutions.com) |
|
| zum Seitenanfang ↑ |
| Aware Technology |
| What-if Modeling |
| http://tomrichards.com/whatif/ |
| Proposes What-if modeling. Description of the principle, list of products and prices, online orderin g. |
| |
| |
| modeling |
| (SLD : tomrichards.com) |
|
| zum Seitenanfang ↑ |
| BYG Software |
| Byg Software's Home Page |
| http://www.bygsoftware.com |
| The Excel Auditor, tool to control, audit, and document workbooks. BYG utilities lite, shareware, Go ldmine, free technique demonstration files, bugs. (BYG stands for Big Yellow Gorilla.) |
| We use Excel, Word, Access, 123, and Approach to develop Solutions to Business Problems. This site c ontains Microsoft Excel audit tools, productivity utilites and demonstrations. |
| Excel,Spreadsheet,Visual Basic,VB,VBA,Visual Basic for Applications,Spreadsheets,Macro,Macros,audit, auditor,123,Lotus 123,Quattro Pro,macros,utilities,shareware,add-ins,consultancy,accounting,accounts ,accountant,Redhill,Reigate,Surrey,Big Yellow Gorilla |
| resvar, mydate, length, bygsoftware, search, winfile, lastday, quattro, macros, button, symphony, ap proach, paradox, msaccess, create, contact, project, favorites, published, updated, windows, excelti ps, substring, function, scrollbars, window, openwindow, software, getfullyear, excellent, recipes, solutions, business, providing, consultancy, financial, feedback, addresses, webcam, height, calenda r, gallery, profile, company, problems |
bygsoftware.com - rank der domain 948580 (65271 in DE)
|
|
| zum Seitenanfang ↑ |
| Excel Magic |
| Excel Magic, home of Inventory Magic |
| http://excelmagic.com |
| Provides custom solutions and assets and inventory control programs. Presentation of the company, de monstrations of the programs and contact information. |
| |
| |
| computer, product, excelmagic, installed, microsoft, inventory, windows |
| (SLD : excelmagic.com) |
|
| zum Seitenanfang ↑ |
| PATools Data Toolkit |
| PATools - Excel business tools for advanced mail merge, label merge, and more ... |
| http://ukww.net/patools/ |
| Add-in for manipulating and analysing data. |
| Run advanced mail-merges entirely in Excel, mailmerge to emails, create labels using only Excel, aut onumber your spreadsheets, and lots more besides - PATools shareware and free software for Microsoft Excel. |
| Excel, mailmerge, mail merge, addin, addon, Exel, Office, free, software, label, mail, merge, advanc ed, business, mail-merge to email |
| scripts, patools, website, allowing, shareware, microsoft, viruses, simply, please, business, advanc ed, webpages, properly, yellow, javascript, enabled, window |
| (SLD : ukww.net) |
|
| zum Seitenanfang ↑ |
| XLStatistics |
| Disclaimer - Individuals' websites |
| http://www.deakin.edu.au/~rodneyc/XLStats.htm |
| Set of workbooks for statistical analysis of data. All working and code is visible. Freeware version available. |
| |
| |
| deakin, university, disclaimer, contents, deakin, isdeakin, individuals, websites, docurl, button, c ontent, expressed, display, author, opinions, webpage, requested, ugetcookie, height, clearer, templ ate, urchintracker, 00113b, provider, ugifpath, represent, opinion, liability, necessarily, assumes, solely, checksegment, isdeakin, cricos, tracking, utmsetvar, opinions, responsibility, continue, re turn, proceed, options, please, return, copyright, feedback, glossary, privacy, accessibility, discl aimer, warrant |
deakin.edu.au - rank der domain 43846 (266 in AU)
|
|
| zum Seitenanfang ↑ |
| O2Olap |
| OLAP Office Explorer |
| http://www.o2olap.com |
| Offers data analysis and reporting tools for budgeting and forecasting. Proposes consulting services . In London, UK. |
| OLAP Office is an innovative Excel pivot table and modelling add-in for Microsoft's Excel, SQL Serve r and Analysis Services. Ideal for accountants, budgeting, forecasting and financial reporting appli cations. There are not limitations and it can be used in any industry! |
| ms, excel, office microsoft, cube, database, sql server, analytics, dashboard, reporting, sql 2005, ado, pivot, sql server 2005, dts, formulas, microsoft excel, microsoft access, spreadsheet, business management, software office, cubes, business intelligence, mdx, mssql, sql server 2000, sqlserver, data mining, ms sql, ssis, excel macro, performance management, reporting services, data analysis, m icrosoft sql server, excel formula, etl, olap, excel formulas, excel ms, excel spreadsheet, analysis services |
| office, microsoft, explorer, solutions, product, padding, function, analysis, margin, services, impr oved, solutions, submenu, dynamics, platform, rpxnow, accountants, integrated, duration, solution, e volve, concept, register, spreadsheet, easeout, transition, transitions, addevent, accuracy, ledger, accounting, budgeting, products, forecasting, solution, system, forecasting, application, previous, everything, reporting, plugins, functionality, product, translate, google, seriously, partner, acco unting, increased, report |
| (SLD : o2olap.com) |
|
| zum Seitenanfang ↑ |
| Jabsoft |
| Excel Sensitivity Analysis, Audit Excel Models, Excel Modeling Analysis , Excel Dashboards Tools, Jabsoft |
| http://www.jabsoft.com |
| Proposes formatting and financial tools. Presentation of the company and the products, online suppor t. In Peru. |
| JABSOFT is a company specialized in the development of decision analysis software and solutions to e mpower individuals and organizations to make better decisions. |
| excel sensitivity analysis, audit excel models, excel modeling analysis , excel dashboards tools, ja bsoft |
| analysis, partners, downloads, support, company, resellers, clients, services, products, dashboards, modeling, models, jabsoft, sensitivity |
jabsoft.com - rank der domain 799111 (290255 in US)
|
|
| zum Seitenanfang ↑ |
| Add-ins.com |
| Add-ins and visual basic macros for Microsoft Excel |
| http://www.add-ins.com/ |
| Proposes collections of add-ins and visual basic macros. |
| Add-ins.com provides Microsoft Excel spreadsheet add-ins and downloadable books on Excel visual basi c macros. |
| excel, addins, macros, visual basic, spreadsheet, macro, books, tips, help |
| products, products, microsoft, download, macros, charts, windows, productivity, assistant, backgroun d, support, popular, creator, product, product, downloadable, download, tahoma, family, downloadable , height, discounts, others, weight, spreadsheet, contact, purchase, sidemenu, immediately, search, feedback, compatible, create, discount, select, signed, digitally, software, releases, customer, com pany, employer, guarantee, satisfaction, insure, bought, licenses, testimonials, duplicates, cascade , upgrades |
add-ins.com - rank der domain 780220 (311734 in US)
|
|
| zum Seitenanfang ↑ |
| Spheresoft |
| Spheresoft - Add-in products for Microsoft Excel |
| http://www.spheresoft.com |
| Proposes the Modeler and the Highlighter tools. |
| Spheresoft develops add-in products for Microsoft Excel and Office |
| Sphere,spreadsheets,Excel,add-in,add-ins,addin,add in,add-on,plug-in,plugin,product,highlighting,zip code,zips,circular reference,software,engineering,software engineering,development,financial,advisor ,application,dynamic,interactive,programming,information,technology,traders,trading,risk,management, foreign exchange,fx,ethiopia,ethiopian,+251,ETC,telecom.net.et,telephone,phone,Outlook,mapi |
| microsoft, spheresoft, download, target, spreadsheet, modeler, addresses, highlighter, allows, dista nce, trademarks, office, featured, magazine, software, targeted, changes, information, includes, dow nloaded, demographics, thousands, received, indicative, access, demographic, rights, reserved, regis tered, sphere, engineering, corporation, united, 1369436, urchintracker, states, countries, thanks, segment, mailing, marketers, direct, housing, income, please, population, enables, create, spreadshe ets, models, circular |
| (SLD : spheresoft.com) |
|
| zum Seitenanfang ↑ |
| ExcelShield |
|
| http://www.excelshield.com |
| A security solution that encrypts all formulas, restricts user rights and removes hidden sensitive d ata from workbooks. In Vienna, Austria. |
| |
| |
| |
| (SLD : excelshield.com) |
|
| zum Seitenanfang ↑ |
| Fas Formulas |
| Fast Formulas - Interactive Spreadsheets Configured with Textbook Formulas |
| http://www.fastformulas.com |
| Proposes spreadsheets configured with interactive formulas in many different subject areas. |
| MS Excel spreadsheets configured with formulas in many different subject areas - Finance, Marketing, Operations Management, Accounting, Electrical, Mechanical and Civil Engineering |
| formulas, spreadsheets, formula, spreadsheet, excel, engineering, finance, marketing, operations man agement, business, electrical, mechanical, civil, economics, interactive, accounting, circuits, thre e phase, academic, textbook |
| formulas, formulas, spreadsheets, spreadsheets, better, formula, configured, interactive, already, s preadsheet, another, created, rather, computer, somewhere, hidden, software, custom, operations, acc ounting, finance, including, management, economics, download, engineering, subjects, textbook, textb ook, configured, different, website, documents, window, screen, immediately, values, results, variab les |
| (SLD : fastformulas.com) |
|
| zum Seitenanfang ↑ |
| AbleBits |
| Excel Pivot table formatting. AutoFormat for PivotTables templates |
| http://www.pivot-table-autoformat.com |
| Provides Pivot Table AutoFormat XL, allowing the creation of collection of autoformats. |
| Free excel add-in that simplifies Excel pivot tables formatting and selecting within pivot table are a / range. Create and apply pivot table templates in a click. |
| |
| pivottables, microsoft, autoformat, pivottable, license, format, express, custom, formats, templates , outlook, windows, template, upgrades, credit, se4uir, collection, templates, transfer, online, for matting, button, office, ablebits, formicrosoft, payment, collection, se4uirs, special, within, trad emarks, paypal, stores, schools, helper, format, minutes, dicount, questions, document, satisfied, r emover, install, layout, purchase, updates, fields, laptop, renewal, manager, wordtable |
| (SLD : pivot-table-autoformat.com) |
|
| zum Seitenanfang ↑ |
| DigDB |
| Excel Add-ins, Advanced Excel Tips - DigDB |
| http://www.digdb.com |
| Proposes a tool for difficult data manipulations. |
| Excel Add-ins for power users - Advanced Excel Tips - enhance Excel Filter & Pivot Table,
Merge Join Tables, Find Duplicates, Sort, Convert,
a simple alternative to Access |
| Excel add-in, Excel power user, Excel add-ins,
Excel tool, Excel pl ug-ins |
| convert, filter, extract, tables, values, combine, columns, column, length, random, delete, select, microsoft, sheets, advanced, filter, remove, values, access, uniques, elites, contact, purchase, sel ect, analysis, minutes, features, testimonial, download, wildcard, intervals, median, trademarks, ra ndom, conditions, duplicates, number, unique, selected, ranges, median, copyright, interpolate, comb inations, spaces, delimiter, before, column, append, office, manipluation |
digdb.com - rank der domain 335396 (129537 in US)
|
|
| zum Seitenanfang ↑ |
| NEKO to Excel |
| NEKO to Excel / Free Download Site of Excel Games |
| http://www.geocities.co.jp/SiliconValley-Cupertino/5678/ |
| Proposes free games for Excel, developed with VBA. |
| Excel Games |
| VBA,Macro,Excel games,free game,Microsoft,MS,exel,xcel |
| download, readme, system, required, folder, directory, enable, macros, download, witness, microsoft, therefore, utilizes, application, marshal, excellonii, tamtam, erohexomino, window, remain, effect, document, geovisit, spreadsheet, contains, winzip, extract, included, structure, single, maintainin g, finally, japanese, showed, avaricious, ferocious, software, spreadsheet, industrious, softwares, welcome, kouichi, character, unbreakable, invisible, kamikazegeisha, superexcellon, typingrunner, bi lliardsx, typingsoccer, cyclotron |
| (SLD : co.jp) |
|
| zum Seitenanfang ↑ |
| Excel Business Solutions |
| Excel VBA Models - Home |
| http://www.excel-modeling.com |
| Provides several VBA add-ins in the areas of finance and statistics. The source code is unprotected for educational purposes. |
| Affordable learning tools in advanced Excel VBA modeling in finance, statistics, and mathematics thr ough our VBA source code tutorials. |
| Excel VBA Models, Excel VBA Source Code, Lotto Number, Monte Carlo Integration, Black-Scholes Option Pricing Model, Portfolio Optimization, Multiple Regression, Bootstrap, Monte Carlo Simulation, Opti on Greeks, Random Numbers Generator, Log Normal, Log Pearson Type III, Chi-Square, F-Distribution, S tudent-T, Multivariate Standard Normal, Gamma, Beta, Triangular, Binomial, Numerical Searching, Newt on-Ralphson, Secant Method, Implied Volatility, Bisection, Index Option, Currency Option , Futures O ption |
| source, learning, finance, products, modeling, provide, statistics, affordable, programs, modeling, consulting, support, contact, several, models, rights, reserved, statistics, finance, copyright, sec tion, internet, community, prorgrams, package, package, individual, contained, saving, programming, information, models, strive, advanced, developed, packages, mathematics, academic, continues, studen ts, through, statistic, helped, tutorials, fields, purchased, please, professionals, during, unprote cted, purposes |
| (SLD : excel-modeling.com) |
|
| zum Seitenanfang ↑ |
| Spreadsheet Advantage |
| Excel Tools to Compare Excel Spreadsheets and more |
| http://www.spreadsheetadvantage.com |
| Provides utilities including those to compare, analyse, map and track down the sources of circularit ies in spreadsheets. |
| Spreadsheet Advantage is an Excel add-in designed to assist users and developers of Excel spreadshee ts. Our add-in tools allow you to compare Excel spreadsheets or sections of the same worksheet. We i ncrease productivity by letting you focus on the real issues in your spreadsheets. |
| Compare, Excel, Tools, Spreadsheets, Add, In, Add-In, Compare, Analysis, Microsoft, Free, Trial, Dow nload |
| document, spreadsheet, escape, spreadsheet, navigator, location, advantage, referrer, similar, versi ons, quickly, microsoft, affect, structure, screen, compare, search, appversion, calculations, compl ex, models, algorithms, potential, errors, worksheet, windows, cookie, comparison, spreadsheets, cha nges, spreadsheets, various, analysis, circular, australia, issues, 217087, urchintracker, copyright , features, purchase, evaluation, download, filling, details, available, history, purchase, rights, sydney, please |
| (SLD : spreadsheetadvantage.com) |
|
| zum Seitenanfang ↑ |
| ZRandom |
| ZRandom |
| http://www.zrandom.com/ |
| Provides a Mersenne Twister pseudo-random number generator. It can be used from its menu, VBA code a nd in formulae. |
| High quality and high speed random number generator for Microsoft Excel. Uses the Mersenne Twister a lgorithm. |
| Mersenne Twister, Random Number, Random Numbers, Excel, Add-In |
| random, numbers, zrandom, generate, interface, generate, quality, pseudo, formulas, spreadsheet, exi sting, samples, amounts, distributions, interactive, mersenne, twister, microsoft, generator, implem ents, number, algorithm, better, function, discrete, formula, homefaqsupportdownloadregisteraffiliat es, continuous |
| (SLD : zrandom.com) |
|
| zum Seitenanfang ↑ |
| Spreadsheet Detective |
| The Spreadsheet Detective Excel Auditing Add-In Audit AddIn |
| http://www.spreadsheetdetective.com/ |
| Provide reporting and error auditing tools, including ones to show how formulae have been copied, fo llow precedent/dependent relationships, compare workbooks and manipulate named ranges. |
| The Spreadsheet Detective audit utility highlights errors that could easily be overlooked. Graphical annotations highlight inconsistent formulas and the meaning of cryptic A1 references like "= D 34 - F47" are clarified by adding "AutoNames" which are based on cell labels. A sprea dsheet navigator shows precedent/dependent relationships, and numerous reports provide a high level overview of complex models. It can also compare different versions of a spreadsheet. |
| The Spreadsheet Detective, Spreadsheet Professional, Audit Tools, Financial Analyst, Excel Add-In, S preadsheet Errors |
| detective, spreadsheet, auditing, validate, difficult, undetected, errors, errors, financial, caused , spreadsheets, notoriously, ensure, correctness, microsoft, litigation, financial, losses, expensiv e, advanced, feature, download, features, comparing, conditions, formulas |
| (SLD : spreadsheetdetective.com) |
|
| zum Seitenanfang ↑ |
| DiffEngineX |
| DiffEngineX LLC - Compare Excel Sheets Software |
| http://www.florencesoft.com |
| Software to compare Excel spreadsheets and highlight the differences with color. Options exist to hi de matching rows revealing just the differing ones. Site includes news, screenshots, full features l ist, and trial version download. |
| FAST Excel spreadsheet comparison. DiffEngineX compares Excel files (formulae, values, comments, nam es, vba, visual basic, code, macros). Quickly reports on the differences between two workbooks. Vers ion control. |
| compare, comparison, diff, differences, Excel, spreadsheet, spreadsheets, workbook, workbooks, works heet, worksheets, sheet, sheets, document, documents, file, files, software, utility, tool, row, col umn, align, alignment, formula, formulas, formulae, values, names, comments, vba, code, macros, visu al basic for applications, DiffEngineX, version control |
| diffenginex, between, differences, workbooks, modified, discount, columns, compare, croatianczechdan ishdutchestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirish italianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanian russianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish, pagedo wnload, traditional, simplified, select, languageenglishafrikaansalbanianarabicbelarusianbulgarianca talanchinese, trialshort, chinese, guideuser, coupon, disc6428, introductory, summer, reviewsscreens hotstutorial, listsdetailed, control, programmatically, command, interface, arguments, version, duri ng, reporting, original, management, checkout, paypal, license, purchase, reduced, button, personal, rights, reserved, sitemap, business, copyright, license, personal, sheets, software, process, payme nt |
| (SLD : florencesoft.com) |
|
| zum Seitenanfang ↑ |
| SimulAr |
| SimulAr: Montecarlo Simulation in Excel |
| http://www.simularsoft.com.ar |
| Provides Monte Carlo simulation software for the risk analysis of decisions. Their license states us ers must email SimulAr with models developed using their tool. |
| |
| |
| montecarlo, simular, simulation |
| (SLD : com.ar) |
|
| zum Seitenanfang ↑ |
| IPredict |
| Time-Series Forecasting Software, Stock Market Prediction, Sales Forecasting Software |
| http://www.ipredict.it/ |
| Time-series predictions using Bayesian algorithms and Wavelet analysis. |
| Easy-to-use Excel plug-in for business and financial forecasting. Advanced and classical algorithms with automatic Best Fit calculation. Advanced Wavelet forecasting. Better results than anything or a nyone. |
| Time-Series Forecasting Software, Stock Market Prediction, Sales Forecasting Software, Stock Forecas ting, Wavelet, Smoothing, Regression, Time Series, Forecasting |
| forecasting, forecasting, analysis, series, algorithms, smoothing, ipredict, wavelet, moving, market , software, forecast, series, pricing, scholes, document, options, microsoft, allows, pagetracker, m odels, financial, gajshost, signal, digital, processing, kernel, component, services, markowitz, pri ncipal, portfolio, average, pricing, advanced, prediction, technical, computational, performance, av erages, techniques, denoising, active, multiple, rights, reserved, support, projection, benchmarks, regression, copyright |
ipredict.it - rank der domain 965869 (18185 in IT)
|
|
| zum Seitenanfang ↑ |
| DPlot |
| DPlot Graph Software for Scientists and Engineers - Home Page |
| http://www.dplot.com |
| Offers graphing software for scientists and engineers, with the facility to import data from Excel. |
| DPlot Graph Software for Scientists and Engineers. |
| graph software, graphing software, plot software, plotting software, graph, graphing, Excel Add-In, DPlot, HydeSoft, 3D graphics, contour plots, data analysis, data filtering, differentiation, enginee ring, fast Fourier transform, FFT, graphics, graphs, histogram, integration, interpolation, math, ma thematics, regression, science, shareware |
| background, decoration, ltblue, position, program, navcontainer, software, graphs, online, 406786, o thers, options, points, display, viewer, features, repeat, margin, software, plotting, fraction, sam pling, technical, engineers, create, matlab, powerful, sought, surprised, version, without, simple, affordable, across, additional, requirements, padding, gadgets2, images, manual, create, 028400, sci entists, underline, engineers, height, windows, downloadfree, copyright, homeprivacy, method |
dplot.com - rank der domain 849068 (346101 in US)
|
|
| zum Seitenanfang ↑ |
| The Spreadsheet Store |
| Excel Templates | Spreadsheet Templates | The Spreadsheet Store |
| http://www.spreadsheetstore.com |
| Free help, a forum and templates for a wide variety of purposes including stock market, real estate and financial statement evaluation, invoicing and personal finance. |
| Excel templates at The Spreadsheet Store. Download Excel spreadsheet templates, including Excel Gant t chart templates, invoice templates, budgets, business valuation models and more. |
| excel templates,spreadsheet templates,the spreadsheet store,spreadsheet store,excel spreadsheet temp lates |
| templates, valuation, business, spreadsheet, templates, microsoft, template, pagetracker, document, edition, deluxe, manage, calculator, script, inventory, market, business, equity, development, inves tor, estate, invoice, protocol, location, sharepoint, unescape, gajshost, content, spreadsheet, feat ured, 3cscript, market, worksheet, budget, packed, dynamic, wondering, project, management, looking, office, features, dynamicdrive, project, monthly, amortization, financial, statement, schedule, tra ckpageview, company |
spreadsheetstore.com - rank der domain 984647 (403496 in US)
|
|
| zum Seitenanfang ↑ |
| ExcelSavvy |
| ExcelSavvy - spreadsheet professional - Spreadsheet Professional tool, spreadsheet compare tool, Excel compare tool |
| http://www.excelsavvy.com |
| Software to discover spreadsheet errors, help with auditing and understand complex models. |
| SavvyFM - Ultimate financial modelling industry professionals. Leading the way for major accountancy firms, banks and other financial institutions. |
| financial modelling,business modelling,business modelling solutions,model development,model build,Mo del Development,Spreadsheet Professional,spreadsheet compare,Excel compare,spreadsheet comparison,Ac cess Development, excel comparison,spreadsheet innovations,excel audit,spreadsheet audit,Spreadsheet audit,financial model,excel model,spreadsheet model,spreadsheet test,spreadsheet testing,model test ing,Excel testing,Audit Tools,Excel Tools,spreadsheet tools,Excel Add-In,spreadsheet error,Excel err or,spreadsheet dependency,Excel dependency,Spreadsheet check,Excel check,sarbanes-oxley,sarbanes oxl ey,Financial Analyst Tool,Excel detect,Spreadsheet detect,Excel Accounting,Spreadsheet Accounting,Ex cel banking,Spreadseet banking,actuary tools,Excel analysis,Spreadsheet analysis,Financial tools,wor ksheet compare,Excel formula,Excel calculation |
| excelsavvy, reports, solution, excelsavvy, utilities, spreadsheet, professional, errors, functionali ty, financial, compare, computing, latest, compare, potential, worksheet, looking, client, contact, assurance, utilities, purchase, purchase, should, reports, analyst, benefits, mentioned, numbers, ca shflow, originally, played, dollar, transaction, million, valuation, valuation, around, finance, lit tle, director, organisation, within, everyone, provide, individual, trusted, logically, although, co ntact, 4368030 |
| (SLD : excelsavvy.com) |
|
| zum Seitenanfang ↑ |
| Data Manager |
| Data Manager - Database Management Add-in for Excel |
| http://www.datamanagerforexcel.com |
| Transforms Excel into a fully functional database. Allows you to convert worksheets into tables and conduct queries within the Excel environment. |
| Transform your Excel Data Lists into a fully functional database application with this Excel add-in. |
| Excel, form, database, data list, data, query, data validation, sheets, table, fields, spreadsheet, free, formula, download |
| manager, database, features, tables, popupwin, create, fields, command, controls, multiple, particul ar, height, buttons, urlstr, database, software, validation, format, combination, environment, relat ed, entered, management, mailing, contact, include, reporting, quickly, defined, easily, customized, within, worksheets, directories, single, example, currently, entering, provides, request, should, q uestions, labels, process, details, functions, manipulate, leveraging, analyze, numeric, useful |
| (SLD : datamanagerforexcel.com) |
|
| zum Seitenanfang ↑ |
| Easy Spreadsheets |
| EasySpreadsheets, Excel spreadsheets, household budget, college student budget, password organizer, business expense worksheet, conversions, retirement calculations |
| http://easyspreadsheets.stores.yahoo.net/ |
| Proposes spreadsheets budgeting, organizing computer passwords/personal information. Provides online ordering and a download area. |
| EasySpreadsheets is a collection of very easy to use Excel spreadsheet programs for a home budget, a college budget, a personal organizer, business expense statements, retirement calculations, conver ting measurement units, and more |
| Excel spreadsheets, budget, budgeting, household budgeting, household budget, home budget, college b udget, budgets, EasySpreadsheets, universities, college, Excel 97, Excel 95, Excel 2000, home financ es, college finances, personal finances, family finances, family budget, college student budget, col lege student budgeting, student finances, college parents, easy spreadsheets, information organizer, password organizer, spreadsheet organizer, Password Vault, password protected organizer, personal o rganizer, expense worksheet, expense account, retirment, retirement financial calculations, retirmen t calculations, pension calculations, net worth, college tuition investments, retirment budget, reti rement investment plan, retirment investments, converting, converting measurements, converting units , converting centigrade to fahrenheit |
| spreadsheets, budget, programs, important, spreadsheet, easier, written, microsoft, faster, laboriou s, password, organizer, business, student, college, easyspreadsheets, household, expense, worksheet, collection, calculationseasyspreadsheets, conversions, retirement, intuitive |
| (SLD : yahoo.net) |
|
| zum Seitenanfang ↑ |
| PrecisionCalc |
| Precision Calc - More Power From Excel |
| http://precisioncalc.com |
| Allows mathematical formulae to provide much more precise results, use of larger and smaller numbers and eliminates binary conversion errors. |
| |
| |
| fcontent, microsoft, document, getelementbyid, startcolor, edition, precisioncalc, inspector, xlprec ision, program, fscroller, manager, scroller, closetag, begintag, macros, business, miliseconds, cha nge, function, custom, created, length, innerhtml, colorfade, plains, content, accuracy, provides, f adelinks, wanted, linkcolorchange, functions, download, products, resources, powerful, stepdelay, en dcolor, maxsteps, program, worksheet, search, programming, solutions, myself, precise, trying, every thing, spending, clientele |
| (SLD : precisioncalc.com) |
|
| zum Seitenanfang ↑ |
| Lindo Systems |
| LINDO Systems - Optimization Software: Integer Programming, Linear Programming, Nonlinear Programming, Global Optimization |
| http://www.lindo.com |
| What's Best allows the creation of optimization models in Excel. It solves linear, nonlinear and int eger programming problems. |
| LINDO Systems develops software tools for optimization modeling. We offer solvers and a featured env ironment for Linear Programming, Nonlinear Programming, Integer Programming and Global Optimization models. Our products include Lindo API, LINGO, and What'sBest for Excel. |
| global optimization, software, maximize profit, cost reduction, Excel optimization, Excel add-in, op timization, models, spreadsheet optimization, What'sBest!, financial models, business application, c ost minimization, LINGO, models, solver, linear, nonlinear, integer, convex nonconvex, quadratic, q uadratically constrained, Integer Optimization, programming, optimization environment, optimization tools, built-in solvers, data, database, customized optimization applications, mathematical, Optimiz ation, Lindo API, API, Application Programming Interface, solvers,routines,mathematical programming, MATLAB, MATLAB function, MATLAB optimization, custom, algorithms, unbounded models, downloads, prod uction planning, transportation, finance, portfolio allocation, capital budgeting, blending, schedul ing, inventory, resource allocation, |
| optimization, programming, models, optimization, systems, linear, release, integer, solvers, softwar e, includes, introducing, applications, solver, allocation, enhancements, incorporate, uncertainty, powerful, linear, integer, nonlinear, nonlinear, systems, global, solving, global, building, softwar e, leading, features, supplier, featureslindo, modeling, combination, perfect, programming, stochast ic, better, shipping, scheduling, inventory, blending, budgeting, portfolio, capital, resource, copy right, rights, reserved, finance |
lindo.com - rank der domain 779533 (305699 in US)
|
|
| zum Seitenanfang ↑ |
| Business Functions |
| Business Functions - freeware Excel modelling library |
| http://www.businessfunctions.com |
| Excel functions for projecting costs and revenues, coping with time periods and growth. |
| |
| |
| padding, border, height, bottom, 8994a7, vertical, margin, weight, background, business, functions, 3a3a3a, ffffff, decoration, verdana, family, position, d9e4f7, cookie, function, function, select, i mages, display, 1c1c1c, collapse, relative, textarea, property, webpure, 898f98, 607ab5, estate, a7b 2c5, overview, library, access, button, center, functions, popular, product, spreadsheet, repeat, ca lculation, cashflow, administrator, really, rating, professional, support |
businessfunctions.com - rank der domain 929116 (394991 in US)
|
|
| zum Seitenanfang ↑ |
| Palo |
| Palo for Excel |
| http://www.palo.net |
| Open Source OLAP software ideal for budgeting and forecasting |
| Multidimensional In-Memory OLAP Database for Planning, Analysis and Reporting in Microsoft Excel |
| excel, olap, molap, business intelligence, planning, in-memory, powerpivot, analysis, reporting, cor porate performance management, pivottabelle, unternehmensplanung, access, sverweis, hverweis, mis, e is, palo, open source, compliance |
| planning, function, document, download, values, trademark, reporting, database, formula, software, s ource, registered, videos, sophisticated, noconflict, business, enabled, intelligence, charge, centr ally, jquery, manner, planning, tables, datapalo, perfect, sidebar, gajshost, pagetracker, storage, accordion, network, featurenav, handling, easily, central, download, installation, oracle, integrate , yourself, instance, generated, directions, server, integration, possible, therefore, number, javas cript, script |
palo.net - rank der domain 915206 (65355 in DE)
|
|
| zum Seitenanfang ↑ |
| Knowledge Dynamics |
| KDCalc |
| http://www.kdcalc.com |
| Turns Excel workbooks into interactive web applications. |
| |
| |
| kdcalc, solutions, features, microsoft, enterprise, interfaces, generates, calculation, supported, a pplications, applications, spreadsheets, calculation, management, business, engines, familiar, alrea dy, scalable, engine, create, director, support, registered, trademarks, become, affiliate, owners, respective, studies, insurers, governments, critical, customers, mission, reporting, quoting, produc t, configuration, engines, overview, crafted, generated, trading, financial, banking, finance, insur ance, actuarial, available, performance |
| (SLD : kdcalc.com) |
|
| zum Seitenanfang ↑ |
| Mapland |
| Excel Add in - Mapland Mapping Software works inside Microsoft Excel |
| http://www.softill.com |
| Spreadsheet mapping software that allows you to chart Excel data on a map. |
| Mapland add in mapping software works inside Microsoft Excel. Mapland allows you to map your data qu ickly and easily. Insert your maps into PowerPoint, Word, Photoshop and Illustrator. |
| mapland, excel add in, usa county boundaries, mapping software, us map, political boundary maps, map ping in excel, base map, pin map, boundary maps, msa, msa map, state zip code map, cbsa map, map sof tware, fcc market boundaries, africa countries, area code map, asia countries, business mapping, cou nty maps, celluar market area, county boundaries, data mapping, demographic data, excel add in, exce l maps, microsoft map, fips codes, geocoding, geographic software, data mapping, map of the world, o utline maps, push pin map, postal codes, software illustrated, spreadsheet map, map by zip code, uni ted states map, sales territory mapping, zip code map, zip code boundaries, canada map, world countr ies, ZIP, world cities, usa maps, shaded map, 5 digit zip code map, 3 digit zip code map, north amer ica map, zip code map of |
| mapland, centroids, boundaries, locations, microsoft, software, mapping, mexico, boundaries, postal, county, spreadsheet, display, numbers, inside, illustrated, market, easily, combine, canada, contac t, purchased, provide, geographic, workbooks, publications, illustrator, detailed, dynamic, frontpag e, presentations, powerpoint, additional, metropolitan, statistical, download, information, compatab ility, benefits, objects, features, customized, professional, reserved, rights, copyright, serving, customers, scientific, united, states |
softill.com - rank der domain 951412 (408300 in US)
|
|
| zum Seitenanfang ↑ |
| Business Spreadsheets |
| Excel Templates for Business: Download Excel Templates |
| http://www.business-spreadsheets.com |
| Sells templates designed for project management, business analysis, investment and option valuation, multiple regression forecasting, portfolio monitoring and optimization. |
| Excel templates for business finance and financial analysis: download free Excel templates for busin ess and find Excel solutions for business purposes. |
| excel, templates, free, download, add-ins, spreadsheets, solutions, business, microsoft |
| business, download, business, templates, spreadsheets, return, templates, solutions, document, cooki e, solutions, function, location, making, decision, analysis, scenarios, escape, quality, management , accurate, valuation, portfolio, specific, results, directory, support, script, gajshost, header, p roduce, considerable, development, simple, pagetracker, empower, provides, unescape, including, enab led, applied, regexp, financial, explore, markets, operations, detailed, productivity, decision, for ums, related |
business-spreadsheets.com - rank der domain 601375 (244149 in US)
|
|
| zum Seitenanfang ↑ |
| Spreadsheet Tools |
| LockXLS - Workbook Copy Protection |
| http://www.LockXLS.com |
| LockXLS protects VBA and spreadsheet formulae from reverse engineering and provides trial period fun ctionality. |
| Workbook Copy Protection for Microsoft Excel 2007, Excel 2003, 2002 (XP), 2000, custom add-ins |
| |
| document, lockxls, locked, activation, workbook, function, nwidth, customer, styleofdiv, documentele ment, divobject, create, product, customers, height, nheight, getelementbyid, protection, registrati on, features, information, hardware, formulas, showimage, scaption, protected, images, creates, opti ons, password, hardware, period, window, element, package, spreadsheet, documents, clientwidth, need ed, converted, deploy, application, applications, specific, library, computer, during, download, rev iew, runtime, unlock |
lockxls.com - rank der domain 907781 (389533 in US)
|
|
| zum Seitenanfang ↑ |
| SBS Development |
| XL-DBQuery a Microsoft Office Excel Add-In to Query Data |
| http://www.xl-dbquery.com |
| XL-DBQuery is an alternative to Microsoft Query and allows you to query and analyse your data. |
| XL-DBQuery a Microsoft Office Excel Add-In to query, import and analyse data and create reports from
ODBC Compliant databases, Excel, SQL, Add-in, Query tool, ODBC, Database, Select |
| excel, add-in, add in, excel report, query builder, sql, spreadsheet, add-ins, query data,
sql serv er, access, db2, oracle, select, sql excel add-in for excel |
| dbquery, pivottables, analysis, business, leverage, document, mining, microsoft, function, location, perform, sophisticated, services, request, feature, experts, awards, leading, managers, rapidly, ve rsatile, trends, analyse, easily, decisions, approach, visual, powerful, expense, consultants, compl ete, potential, fullest, builder, without, prices, customer, comments, content, products, assessed, render, should, dbqueryv1, downloads, office, download, dbquery, browser, default, chosen |
| (SLD : xl-dbquery.com) |
|
| zum Seitenanfang ↑ |
| Project KickStart |
| Project KickStart: Exports to Microsoft Excel |
| http://www.projectkickstart.com/products/excel.cfm |
| Project management add-in. Link to Excel for adding detail, sorting, filtering, and sharing data. |
| Project KickStart exports directly to Microsoft Office, including Excel, PowerPoint, Outlook, Word, Microsoft Project. |
| exports, links, Excel, Microsoft Office Integration, PowerPoint, Outlook, Word, Microsoft Project, M icrosoft PowerPoint, planning, Microsoft Excel compatible, Microsoft Excel add-on, Microsoft Power Point add on, Microsoft PowerPoint add-in,Microsoft Excel front end, Microsoft Office Solution Provi der, Project KickStart |
| project, kickstart, management, microsoft, project, schedule, management, support, software, downloa d, reports, pricing, products, customers, report, planning, thought, downloads, templates, members, education, industry, process, stakeholders, thinking, clients, windows, create, pagetracker, proposa ls, customer, gajshost, company, technical, projects, trainers, consultants, videos, office, resourc e, sorted, document, profit, better, instance, criteria, filter, trackpageview, 1625255, requirement s, minutes |
projectkickstart.com - rank der domain 896978 (366710 in US)
|
|
| zum Seitenanfang ↑ |
| Leaning Birch Software |
| Property and Casualty Insurance Sofware - Fountainhead |
| http://www.leaningbirchsoftware.com/ |
| DiagramEX provides a graphical user interface for the entry and modification of Excel formulae. |
| Fountainhead is a new web based tool set that allows property and casualty insurance carriers to des ign, develop and deploy insurance products – quickly and reliably. |
| |
| fountainhead, deploy, insurance, products, design, software, quickly, leaning, casualty, develop, in surance, property, industry, enhancements, reliably, toolset, powerful, developed, construct, months , ideally, should, easily, benefits, features, company, style1, sofware, releases, architecture, all ows, technical, demonstration, contact, overview, professionals |
| (SLD : leaningbirchsoftware.com) |
|
| zum Seitenanfang ↑ |
| ExcelCalcs |
| www.excelcalcs.com - Home |
| http://www.excelcalcs.com |
| Displays Excel formulae as mathematical equations. |
| XLC software to display MS Excel formulae in mathematical notation. Repository of solved problems co vering many engineering topics. Site forum for software support and discussion of calculation. Engin eering spreadsheets. |
| excel, mathcad, mathematica, calcs, excel calculations, xlc, solved problems, excel formulae, spread sheets, engineering spreadsheets, engineering templates, engineering calculations, formulas, formula , worked solution, roark formulas,roark's formulas |
| module, moduletable, padding, margin, transitions, discuss, transition, duration, repository, latest , window, issues, password, header, hilite6, hilite7, hilite8, hilite9, calculation, subscription, e aseout, overeffect, hilite5, enabled, outeffect, easein, hilite4, height, general, excelcalcs, addev ent, excelcalcs, hilite1, modules, function, domready, hilite3, hilite2, testimonials, suggestions, recommend, website, calculation, harrison, conrad, playground, hunter, studies, featured, channel, y outube |
excelcalcs.com - rank der domain 996589 (409375 in US)
|
|
| zum Seitenanfang ↑ |
| MacroRunner |
| MacroRunner - Automate your Excel Macros |
| http://www.macrorunner.com |
| Automates the process of running Excel macros. |
| Automate your Excel Macros with this powerful Excel add-in |
| Excel, Macro, Automate, Run, Add-in, Excel Add-in, Excel Formula, Excel Macro, Formula |
| macrorunner, macros, function, runmacro, condition, evaluates, allows, macros, response, worksheet, several, whether, values, options, choose, including, automate, different, number, method, operator, solutions, comparing, consists, comparision, specify, involved, programming, function, mentioned, c ontact, returned, comparison, another, single, powerful, enables, download, enlarge, purchase, inser ted, methods, document, allowing, involves, addition, called, defined, provides, workbook, related |
| (SLD : macrorunner.com) |
|
| zum Seitenanfang ↑ |
| ExcelSentry |
| Welcome to ExcelSentry - real spreadsheet security |
| http://www.excelsentry.com |
| Encrypts spreadsheets allowing normal operations only for authorized users. |
| Welcome to ExcelSentry
We are pleased to announce the release of an Excel 2007 version of ExcelSent ... |
| spreadsheet security, excel security, formula encryption, persistent security, location security, in tellectual property, strong encryption, worksheet protection, AES/Rijndael, ExcelSentry, ExcelSentry |
| 153153, 627893, decoration, normal, visited, active, weight, verdana, family, helvetica, underline, heading, pagehead, productlisting, border, colhead, coltext, parahead, footer, breadcrumb, excelsent ry, ffffff, background, spreadsheet, sentry, bottom, spreadsheets, welcome, dollar, security, versio n, provides, announce, pleased, release, website, comprehensive, robust, microsoft, encodes, availab le, spreadsheetsentry, dashed, dashedline, calendarbg, calendarleftbg, variant, calendarrightbg, col line, spreadsheet, margin |
| (SLD : excelsentry.com) |
|
| zum Seitenanfang ↑ |
| GamesExcel |
| Gamesexcel.com your Excel Games web |
| http://www.gamesexcel.com |
| Collection of games for Excel. |
| Gamesexcel.com is a Web dedicated to the compilation of Excel games, now you will be able to enjoy t he classic games in your spreadsheets Excel. Each Excel game contains a link to another descriptive game page, where you can download the game as well as some images and comments on the Excel game. |
| game, games, excel, videogame, vba, flash, quiz, web |
| mydate, gamesexcel, gamesexcel, download, applications, playing, addres, following, putting, updates , language, programated, expanding, images, comments, available, finally, descriptive, mentioned, be fore, participate, contains, powerpoint, another, gamespowerpoint, welcome, getdate, getmonth, favou rite, offered, getday, homepage, gamesexcel, favorites, recommend, getyear, thanks, consist, technol ogy, developed, guessing, questions, certain, divided, persons, development, compiles, football |
gamesexcel.com - rank der domain 987591 (13682 in ES)
|
|
| zum Seitenanfang ↑ |
| ScanXLS |
| Assess Inventory of Spreadsheet files for SOX
(Sarbanes-Oxley) 404 compliance projects, end user controls |
| http://www.sysmod.com/scanxls.htm |
| This tool by Systems Modelling finds the spreadsheets on your network and their links/dependencies. Addresses Sarbanes-Oxley concerns. |
| Excel Spreadsheet .XLS file inventory scanner, compares workbooks, extracts properties, links, error summary data to help focus efforts on internal controls on end-user software application developmen t |
| |
| projects, compliance, controls, spreadsheet, related, internal, assists, originally, conversion, mic rosoft, spreadsheet, models, scanxls, developed, development, scanxls, price1, sarbanes, assess, inv entory, listing |
sysmod.com - rank der domain 994317 (1822 in IE)
|
|
| zum Seitenanfang ↑ |
| xl-IQ Interactive Excel Training |
| xl-IQ Interactive Excel Training |
| http://www.xl-iq.com |
| Add-in that teaches you how to use Excel through its user-interface. |
| xl-IQ - Interactive Excel Training: xl-IQ is an interactive computer-based training program that is built-in to Excel. It provides interactive training exercises within Excel's normal user interface, guiding users through each feature of Excel, actively demonstrating how each of these features can b e used, while allowing the user to explore the examples as they develop within each exercise. xl-IQ provides training on demand, where users can choose exactly which new features they wish to learn, c an learn at their own pace, as well as enabling them to quickly apply these new techniques within th eir own workbooks. |
| xl-iq, Excel, training, interactive, learning, tutorials, teaching, finance, add-in, software, appli cation, superscript, solutions |
| training, examples, within, exercises, version, easily, training, transition, available, develop, ex plore, around, features, advanced, intermediate, beginner, covers, simulates, whenever, learning, wo rkbook, exercise, progresses, unique, screenshots, product, superscript, solutions, copyright, limit ed, functionality, search, follow, features, workbooks, improved, welcome, interactive, covering, co ntact, detailed, introducing, download, eeece1, devoted, background, recorded, interactive, purchase , activate, simulates |
| (SLD : xl-iq.com) |
|
| zum Seitenanfang ↑ |
| Excel Quick Search |
| MacroUnit Excel Quick Search home |
| http://excelquicksearch.com |
| Tool which extends Excel's search facilities. |
| |
| |
| |
| (SLD : excelquicksearch.com) |
|
| zum Seitenanfang ↑ |
| Quick Excel |
| Quick Excel |
| http://www.quickexcel.com |
| This add-in provides a simple, ergonomic way to enter data. |
| This add-in provides a simple, ergonomic way to enter data. |
| excel, microsoft excel, add-in, quick excel |
| address, invalid, address, spreadsheets, tutorials, return, validate, function, document, elements |
quickexcel.com - rank der domain 440478 (183536 in US)
|
|
| zum Seitenanfang ↑ |
| Moverve |
| Moverve.com Reconciliation Experts - Reconciliation tools |
| http://www.moverve.com |
| UK company providing Isolist for data matching and reconciliation. |
| |
| |
| matching, reconciliations, moverve, reconsilo, software, isolist, reconciliation, reconciliation, do wnload, contact, gajshost, document, script, function, pagetracker, slides, engine, overview, reconc ile, google, duties, simplifies, positional, should, result, analysis, sources, editor, perfect, bet ween, tables, single, effective, enabling, investigation, requirements, training, reduced, solution, lowest, 3cscript, unescape, analytics, location, protocol, 1786808, trackpageview, gettracker, java script, summary, comprehensive |
| (SLD : moverve.com) |
|
| zum Seitenanfang ↑ |
| Boardwalktech |
| Enterprise Collaboration | Boardwalktech |
| http://www.boardwalktech.com |
| Software to allow several users to work on the same spreadsheet data using server-side change manage ment. |
| Boardwalktech provides software and services to support collaboration between desktops and the exten ded enterprise |
| project management software, collaboration, spreadsheet, database, s&op, enterprise 2.0, excel, supply chain management software, project tracking software, revenue forecasting, unit forecasting |
| enterprise, management, enterprise, solutions, boardwalktech, desktop, companies, editionbcp, compli ance, runcontent, platform, report, planning, collaborative, document, generation, rapidly, gajshost , quality, company, supply, software, images, macromedia, business, budgeting, pagetracker, portfoli o, operations, runactivecontent, partner, forecasting, revenue, performance, demand, treasury, proce ss, partners, collaboration, processes, productivity, significant, realize, possible, unprecedented, deliver, bridge, between, working, microsoft, architect |
| (SLD : boardwalktech.com) |
|
| zum Seitenanfang ↑ |
| MSDN: Isolating Microsoft Office Extensions with the COM Shim Wizard Version 2.3 |
| Isolating Microsoft Office Extensions with the COM Shim Wizard Version 2.3.1 |
| http://msdn.microsoft.com/en-us/library/bb508939.aspx |
| Software developers can isolate managed add-ins using this free COM Shim Wizard. |
| |
| |
| office, wizard, managed, microsoft, wizard, application, custom, interfaces, object, visual, version , assembly, implements, studio, interface, system, figure, domain, automation, because, example, ext ensibility, target, project, configuration, outlook, managed, install, additional, sample, iribbonex tensibility, component, registry, folder, managedaggregator, implement, extension, method, methods, components, dialog, ondisconnection, idtextensibility2, registration, loaded, entries, release, ribb on, includes, register, should |
microsoft.com - rank der domain 31 (17 in US)
|
|
| zum Seitenanfang ↑ |
| Excelential |
| Excel Dashboards Made Easy |
| http://www.excelential.com |
| Changes And Trends Software offers a product which allows you to see the important parts of your spr eadsheets on a dashboard. |
| Excelential allows you to view and work with your Excel spreadsheet files on a dashboard. |
| Excel dashboards, Excel spreadsheets, Excel reports, Excel files, overload |
| spreadsheets, dashboard, struggling, excelential, overdose, dashboards, products, articles, support |
| (SLD : excelential.com) |
|
| zum Seitenanfang ↑ |
| SQL Drill |
| SQL Drill - Freeware Database Add-in |
| http://www.sqldrill.com |
| Freeware which can be used to connect to and import from ODBC compliant databases. |
| SQL Drill - Freeware Database Add-in |
| sql, query, Excel, VBA, Office, vba, macros, formulas, xls, addins, vb, programming, microsoft |
| database, microsoft, connection, different, version, standard, connect, installation, toolbar, objec ts, available, install, databases, combobox, dropdown, quickly, document, google, whether, pasted, t ables, selecting, standard, options, applied, select, gajshost, toolbar, unescape, selectable, trans late, access, server, pagetracker, interface, access, functionality, profile, versions, version, upg rade, numerous, switch, button, automatic, location, filters, protocol, report, headings, please |
sqldrill.com - rank der domain 944858 (324731 in US)
|
|
| zum Seitenanfang ↑ |
| Enventra |
| Enventra - MoboCalc Overview - The Tablet PC Input Panel for Microsoft Excel |
| http://www.enventra.com/products/mobocalc.htm |
| Produces MoboCalc which supports pen input for Excel on tablet PCs through a custom Excel tablet inp ut panel. Features natural maths notation and function shortcuts in formulas. |
| |
| worksheet, Vista, UMPC, ultra-mobile PC, tablet PC, purchase, pen input, pen, Office, MoboCalc, form ula, Excel, Enventra, download, buy |
| pagetracker, document, enventra, gajshost, google, 3cscript, unescape, location, agency3, protocol, analytics, gettracker, 4770144, trackpageview, initdata, script, javascript, reserved, function, sfh over, getelementbyid, getelementsbytagname, microsoft, overview, mobocalc, tablet, rights, policy, p rivacy, products, support, contact, website |
| (SLD : enventra.com) |
|
| zum Seitenanfang ↑ |
| Phraseswapper |
| PhraseSwapper Home |
| http://www.phraseswapper.com/ |
| A utility that aids with translation and cleanup of Excel spreadsheets. It captures and lists all wo rds in the spreadsheet, allowing the user to globally substitute alternate words. |
| Phraseswapper: list and exchange text in a Microsoft Excel based file. Exchange the list of origina l phrases using one or more alternate lists from any language. |
| Microsoft Excel Globalization, Content Discovery, Repurpose, Computer Aided Translation, Microsoft W indows |
| phraseswapper, microsoft, library, language, download, replace, support, contact, places, designed, consistent, windows, exchange, search, function, hlinkbuynow, different, paypal, trademarks, numbers , acquire, locations, globalization, reserved, assign, alternates, arduous, exchange, elements, cont ain, easily, overlooked, manual, spreadsheet, change, transform, simple, additional, privacy, polici es, website, office, visiting, registered, toolsleuth, copyright, corporation, united, states, count ries, walkthru |
| (SLD : phraseswapper.com) |
|
| zum Seitenanfang ↑ |
| Trace |
| Spreadsheet audit / Visualize cell dependencies or relationships / Trace / Excel |
| http://www.christopherteh.com/trace/ |
| Draws dependency graphs/diagrams to depict relationships between cells in Excel. Use this tool for s preadsheet auditing, mathematical modeling, and other calculations. Trace is freeware. |
| Visualize cell relationships, dependents, and precedents in Excel for spreadsheet verification, audi ting, and modeling |
| |
| following, dependency, sheet2, graphs, worksheet, sheet3, because, relationships, example, software, refers, formula, values, graphviz, ellipse, workbook, income, diagrams, worksheets, language, comme rcial, expense, depict, spreadsheet, version, tripleoctagon, written, spreadsheet, select, produce, computer, produces, programmer, spreadsheets, tracing, external, external, include, resources, windo ws, create, cluster, previously, mathematical, purposes, tracing, information, picture, calculate, f unctions, resources |
| (SLD : christopherteh.com) |
|
| zum Seitenanfang ↑ |
| User Solutions |
| Our Products : Project Management Software : Job Scheduling Software : Manufacturing Software : UserSolutions.com |
| http://www.usersolutions.com/products.html |
| Solutions for scheduling, material control, graphing and time sheets. |
| Project Management Software, Job Scheduling Software and Manufacturing Software are some of the many products and services we can offer you at Usersolutions.com. |
| Manufacturing Software, Software Manufacturing, Scheduling Software, Project Management Software, Jo b Scheduling Software |
| manager, lessons, spreadsheet, ozgrid, decoration, software, scheduler, resource, products, operatio ns, footerlink, management, 999999, advanced, solutions, userform, courses, training, source, userwa re, pricing, pagetracker, background, underline, scheduling, product, repeat, gajshost, document, su ccess, releases, stories, sitemap, planning, contact, partners, 8145266, levels, rights, trackpagevi ew, gettracker, tricks, userforms, script, 3cscript, content, protocol, google, unescape, copyright, analytics |
| (SLD : usersolutions.com) |
|
| zum Seitenanfang ↑ |
| SolveXL |
| SolveXL - Optimization add-in for Microsoft Excel |
| http://www.solvexl.com |
| Single and multiple-objective genetic algorithms optimization add-in for Microsoft Excel. |
| Joomla! - the dynamic portal engine and content management system |
| joomla, Joomla |
| solvexl, microsoft, optimization, objective, algorithms, forgot, column, population, multiple, resul ts, optimization, backups, intermediate, excludemodules, saving, multipliers, automatic, graphical, progressautomation, visualization, penalty, constraints, suspend, resume, browse, packages, simulati on, support, integration, interactively, multiple, defined, browser, latest, rights, reserved, copyr ight, urchintracker, joomla, license, software, released, 5671241, tutorial, instructions, technique s, installation, username, password, username, password |
| (SLD : solvexl.com) |
|
| zum Seitenanfang ↑ |
| Macabacus |
| Macabacus Macros - Excel Keyboard Shortcuts & Productivity Tool |
| http://macabacus.com/excel/macros |
| Provides keyboard shortcuts designed for use by members of the financial community. |
| Macabacus Macros for Excel include keyboard shortcuts that increase speed and save time |
| Macabacus macros Excel 2003 2007 shortcuts keyboard add-in addin DealMaven financial modeling |
| macabacus, macros, powerpoint, document, windows, useful, slides, presentations, productivity, short cuts, install, please, financial, shortcuts, keyboard, processing, installed, office, supported, ver sions, conflict, worksheet, transition, shapes, import, linked, formats, presentation, shortcut, key strokes, features, selected, downloading, settings, feedback, automatically, before, finance, easier , screenshots, products, pagetracker, testimonials, reduce, microsoft, gajshost, preformatted, appea rance, generate, contents, trackpageview |
macabacus.com - rank der domain 353823 (146983 in US)
|
|
| zum Seitenanfang ↑ |
| Dutchcode |
| Add a third dimension to Microsoft Excel with the Timeslider |
| http://www.dutchcode.com |
| Timeslider adds the third dimension of time to your spreadsheets |
| Excel Add-in that allows you to store historical data in spreadsheets |
| Excel Add-in that |
| pagetracker, timeslider, gajshost, document, microsoft, trackpageview, historical, location, downloa d, modules, 8918765, tlookup, dimension, protocol, header, script, javascript, analytics, google, 3c script, unescape, gettracker, currencies, example, exchange, generated, exchange, foreign, external, download, trdlname, trlkname, trmlname, versions, initdata, mailto, copyright, dutchcode, transform , missing, capsules, engine, features, yourself, worked, function, domready, addevent, window, conte nt, inputsexclusion |
| (SLD : dutchcode.com) |
|
| zum Seitenanfang ↑ |
| Excel Planet |
| Excel Planet: Power Tools For Excel |
| http://www.excelplanet.com |
| Multiple utilities such as a graphical calendar and a tool to spot duplicates in lists. |
| Microsoft Excel Utilities Software and AddIns |
| Excel, software, component, utilities, add-in, add in, addin, tools |
| planet |
| (SLD : excelplanet.com) |
|
| zum Seitenanfang ↑ |
| DatabilioSuite.com |
| Data Conversion Software, Excel add-ins - Databilio |
| http://www.databiliosuite.com |
| Provides data conversion tools allowing the extraction of data from text reports in Excel. |
| Databilio Suite is a software that helps you to extract and convert data. Report Inverter is an Exce l add-in to convert text reports into a database table |
| Databilio,Report Inverter,Excel Add-in,Excel plug-in,Data Extraction,Data Conversion,Data Converter |
| report, micapa, inverter, images, background, microsoft, report, margin, padding, document, gajshost , support, trademarks, purchase, downloads, databilio, pagetracker, conversion, structures, differen t, copyright, reserved, 8948704, rights, trackpageview, dramatically, simplify, reformatting, obtain ed, benefits, exploit, suitably, convert, office, registered, analytics, tables, javascript, locatio n, protocol, unescape, 3cscript, google, script, corporation, united, states, gettracker, countries, ntilde, active |
| (SLD : databiliosuite.com) |
|
| zum Seitenanfang ↑ |
| NodeXL |
| NodeXL: Network Overview, Discovery and Exploration for Excel |
| http://nodexl.codeplex.com |
| Provides an Excel 2007 template allowing the display and analysis of network graphs. Can import grap hs from a variety of formats. |
| |
| |
| nodexl, function, license, software, microsoft, network, university, margin, research, contribution, height, codeplex, display, opendialog, vertices, mastercontent, padding, contributor, columns, retu rn, template, import, codeplex, datespan, example, including, document, distribute, graphs, updatepr ogress, downloads, patent, constraindiv, position, maryland, documentation, window, layout, version, tutorial, searchtext, hovername, network, derivative, hoverpanel, projectcontent, postdownload, var iety, flickr, portion, scrollheight |
codeplex.com - rank der domain 1863 (755 in US)
|
|
| zum Seitenanfang ↑ |
| HayaHaya Flow |
| Haya2.com move to Haya2.jp |
| http://www.haya2.com |
| Add-in to allow the creation of flowcharts describing algorithms, organizational charts etc. Website contains an instructional video, a purchase page and system requirements. |
| |
| |
| available, currently, redirect |
| (SLD : haya2.com) |
|
| zum Seitenanfang ↑ |
| Zementis ADAPA |
| |
| http://www.zementis.com/Excel-Ai.htm |
| Predictive analytics add-in allows scoring of data and the execution of complex statistical models. Links exist to the same software as a service and running outside of Excel. |
| Predictive Analytics and Cloud Computing |
| add-in for excel, predictive analytics, score data, on the cloud |
| download, shockwave, version, shockwaveflash, quality, pluginspage, height, macromedia, runcontent, codebase, swflash, microsoft, version, models, pagetracker, predictive, trademarks, menutop, menufoo ter, gajshost, access, password, document, products, fingertips, directly, analytics, predictions, d esktop, scoring, menuside, office, information, community, visiting, contacting, prefer, coffee, mat ter, attire, literally, predictions, javascript, 3cscript, google, script, zementis, initdata, track pageview, 3505512, gettracker |
| (SLD : zementis.com) |
|
| zum Seitenanfang ↑ |
| FlowBreeze |
| Flow Chart Software |
| http://www.breezetree.com |
| Provides an add-in that converts text into flowcharts. Website includes templates, demonstration vid eos and a help file. |
| Flowcharts and Process Maps Made Easy. FlowBreeze converts text into diagrams, automatically applies styles, adds connectors, and much more. |
| flowchart software flow chart charts flowcharts business process improvement documentation tools |
| flowbreeze, breezetree, flowchart, software, process, business, business, document, microsoft, mappi ng, process, gajshost, templates, location, company, mapping, quality, newsletter, download, pagetra cker, flowchart, improvement, analysis, processes, stream, download, appreciate, products, upcoming, mastery, medium, standardizing, improvement, management, activities, whether, operation, striving, diagrams, products, systems, creating, productivity, modeling, javascript, script, analytics, unesca pe, 3cscript, google, gettracker |
breezetree.com - rank der domain 237541 (97825 in US)
|
|
| zum Seitenanfang ↑ |
| SmartChart XP |
| Smart-Chart |
| http://www.smart-chart.info |
| Provides a flow chart generator. Site includes samples, instructional videos and a choice between En glish and German language versions. |
| |
| |
| reserved, rights, impresum, evolution, contact |
| (SLD : smart-chart.info) |
|
| zum Seitenanfang ↑ |
| ARMON Technologies, LLC |
| ARMON Technologies, LLC |
| http://www.armontech.com |
| Developer of XLActuary, an Excel add-in designed to handle all actuarial factor calculations via new worksheet functions. Website includes details about their consultancy, a help file and support info rmation. |
| Software and technology solutions for benefits professionals plus customized Excel /VBA development. |
| ARMONTech, actuarial software, actuarial functions, actuarial service, pension software, defined ben efit software, pension administration software, PPA factors, PPA lump sum, defined benefit administr ation software, retirement software, excel development, excel add-in, excel solution, VBA developmen t, VBA solution, custom VBA, custom Excel, benefit calculation, pension calculation, retirement calc ulation, Excel-based application, custom spreadsheet, actuarial and systems, Excel Six Sigma tools, Excel batch processing, Excel regression test, Excel tool, Excel diagnostic |
| decoration, visited, margin, active, underline, ffffff, actuarial, style4, 333333, style2, 808080, s tyle6, style3, style1, style5, consulting, normal, retirement, administration, provide, development, styles, services, technologies, technology, clients, providers, professionals, benefits, whatever, spreadsheets, benefit, greatest, organization, applications, armontech, servicing, independent, inve stment, consultants, pleased, announce, release, selection, systems, latest, xlactuary, calculating, factors, values, flexible |
| (SLD : armontech.com) |
|
| zum Seitenanfang ↑ |
| Sovereign NewZealand |
| Addins, Add-ins, Goalseek Premium, Customized Solutions by Sovereign Newzealand® 4 |
| http://cargocal.com/SNGSPAnalysis.html |
| Provide an improved GoalSeek algorithm. Site includes a download link and a comparison between the c apabilities of their algorithm with the ones developed by Microsoft and Lotus. |
| |
| |
| solver, cannot, values, target, limitations, changing, change, goalseek, result, algorithm, precisio n, project, variable, multiple, should, workbooks, changes, figure, ullage, column, optimizing, comp uting, contiguous, routines, referenced, called, programmatically, feature, finite, arithmetic, comp uter, required, multiples, detect, bounds, effort, bogged, functions, ranges, height, spreadsheet, i ncorporated, measure, various, problem, potential, internal, premium, determine, formula, goalseek |
cargocal.com - rank der domain 804484 (337769 in US)
|
|
| zum Seitenanfang ↑ |
| Decision Toolworks |
| TreePlan, SensIt, and RiskSim Add-Ins for Excel |
| http://www.treeplan.com |
| San Francisco based software company providing several different add-ins in the areas of decision tr ee diagrams, sensitivity analysis and Monte Carlo simulations. Website also includes sample chapters from a book about decision analysis with Excel. |
| |
| |
| decision, treeplan, analysis, sensitivity, microsoft, simulation, risksim, sensit, toolworks |
treeplan.com - rank der domain 908983 (390257 in US)
|
|
| zum Seitenanfang ↑ |
| Daniel's XL Toolbox |
| Daniel's XL Toolbox - Free and Open-Source Add-In for Excel |
| http://xltoolbox.sourceforge.net |
| Free, open-source add-in for Excel providing data analysis and presentation functions. Site includes the developer's blog and a German language version of the whole site. |
| Daniel's XL Toolbox is a free Add-In for Excel®: Improved ANOVA with posthoc testing, smart cust om error bars, spread scatter, formula builder, group allocation, and much more. |
| |
| dynamicdrive, dynamic, library, notice, source, intact, source, toolbox, daniel, tooltip, balloon |
sourceforge.net - rank der domain 154 (74 in US)
|
|
| zum Seitenanfang ↑ |
| BugdetMedia: Xlquotes |
| xlquotes - Stock Prices for Microsoft Excel© |
| http://www.xlquotes.com |
| Allows users to download stock prices from Yahoo Finance into Microsoft Excel. The site has English and German language versions and a manual. |
| xlquotes is a simple freeware tool which allows you to download stock prices into any spreadsheet. |
| business,share prices,stock quotes,investor,market news,stock research,stock valuation,business news ,economy,financial information,investment,investing,finance,investment tools,mutual funds,quote,stoc k,stocks |
| advertising, 398401, document, undefined, random, finanzen, 10000000000000000, window, google, analy tics, urchintracker, businessplan, shirts, ratgeber, werbung, please, choose, microsoft, xlquotes, p rices, language, sprache, english, deutsch, typeof |
| (SLD : xlquotes.com) |
|
| zum Seitenanfang ↑ |
| Excel Unit Conversion |
| Excel Unit Conversion for process engineers, mass flow, volume flow, celsius to fahrenheit |
| http://www.unitconversionaddin.com |
| Add-in offering unit conversion, dimensional analysis and definition of engineering and periodic tab le constants. Website includes demonstration videos. |
| Excel Unit conversion for Engineers, converting volume, flow rates, pressure, temperature, length, a rea, dimensions, force and more all in SI & American units all in Excel 2007 |
| Excel Unit conversion for Engineers, engineer processes, engineer production, converting volume, flo w rates, pressure, temperature, all SI & American units |
| document, getelementbyid, function, padding, margin, maincontentplaceholder, border, display, backgr ound, content, weight, vertical, bottom, password, mediasetid, action, return, height, center, recor d, select, viewinfobar, conversion, innerhtml, functions, eeffee, repeat, boundsheight, append, radi us, boundswidth, pagetracker, window, position, mediagroupid, backgroundimage, 005500, navigation, s howingfullsize, webkit, inspan, family, embeds, resizeareaid, bounds, widthcopy, heightcopy, header, location, scinfo, ce9000 |
| (SLD : unitconversionaddin.com) |
|
| zum Seitenanfang ↑ |
| Oak Focus Software |
| QueryCell - Use SQL in Excel |
| http://www.querycell.com |
| QueryCell allows you to query Excel data using SQL. Website includes screenshots, tutorials and arti cles. |
| QueryCell, an Excel Add-In, that allows you to use SQL SELECT statements inside Microsoft Excel. |
| SQL, Excel, Microsoft Excel, SQL SELECT, SQL Query, Database, Spreadsheet, Group By, Order By |
| querycell, document, typeof, initialize, function, database, microsoft, without, selecting, insert, statements, protocol, gajshost, pagetracker, bottom, corporation, within, regions, inserts, create, download, oracle, access, source, creating, server, boolean, settings, loaded, location, script, sup port, saving, should, seequel, population, prototype, quickly, columns, googleadservices, source, al lowing, foreign, coloring, google, 3cscript, analytics, unescape, website, associated, runcontent |
| (SLD : querycell.com) |
|
| zum Seitenanfang ↑ |
| CDX Technologies: CDXZipStream |
| CDXZipStream - Excel Zip Code Analysis Addin |
| http://www.cdxtech.com/CDXZipStream/Overview.aspx |
| Provides zip code analysis tools including distance calculations, codes within a given radius, rever se look-ups, address verification and geo-coding. Website includes product features, FAQs, pricing, and a 30 day trial. |
| CDXZipStream is a complete solution for analyzing address and demographic data in Microsoft Excel. C DXZipStream features geocoding, maps, zip code look-up, distance and radius calculations. |
| Excel, MapPoint, Geocoding, Address Verification, Census, Demographic, Zip Code, Add in, Distance, R adius, Reverse Lookup, Zip Code Lists, Maps, Route, Driving Distance, Driving Time |
| cdxzipstream, product, overview, spreadsheet, microsoft, features, available, pricing, software, bus iness, corporate, calculations, formulas, demographic, slideshow, contact, including, quickly, inter face, function, online, existing, select, please, office, simply, import, distance, within, download , required, support, powerful, password, cdxesafefile, versions, address, demographics, account, geo coding, immediately, layouts, entered, custom, financial, screen, guarantee, hughes, modify, places, bringing |
cdxtech.com - rank der domain 950905 (389484 in US)
|
|
| zum Seitenanfang ↑ |
| DataSafeXL Ltd |
| Excel Spreadsheet Protection VBA Security Financial Modelling Dashboards |
| http://www.datasafexl.com |
| Provides software to obfuscate Excel VBA code. Website includes the software download, demonstration video and details of their consultancy and training business. |
| |
| |
| financial, modelling, dashboards, security, spreadsheet, protection |
datasafexl.com - rank der domain 917961 (63350 in DE)
|
|
| zum Seitenanfang ↑ |
|
