| MusicEase Software |
| MusicEase Software |
| http://www.musicease.com/ |
| Music notation software. |
| Music Notation Software for creating publication quality printed music. |
| music notation software, music notation, score editor, music editor, Worship Software, sheet music, midi, tablature, shape note, scanned music, handbell music, SongWright, abc, songwrite, Baptist Hymn al, Celebration Hymnal, Lutheran, Christian, hymn |
| musicease, software, document, pressing, notation, virtual, windows, program, duration, current, sys tem, finale, pieces, changes, script, comments, import, google, lyrics, chords, encore, location, wi ndows, analytics, tablature, though, software, hymnals, pagetracker, previous, 16943796, scanned, au tomatically, instruments, trackpageview, javascript, logical, backspace, quarter, sibelius, protocol , version, worldwide, includes, support, customer, download, gajshost, traditional, version, hymnal |
| (SLD : musicease.com) |
|
| zum Seitenanfang ↑ |
| Roni Music |
| !Slow down and transcribe with Roni Music software - slow down the speed of music without changing the pitch |
| http://www.ronimusic.com/ |
| The main products are the Musician's CD Player and Slow Speed CD Transcriber software. Both products are intended for musicians wanting to slow down music without changing the pitch. |
| Free download of Music/MIDI shareware software. CD-Player - Slow down the speed of music without cha nging the pitch / MIDI |
| MP3, midi, cd-player, shareware,sequencer,midi sequencer,slow, down, speed, change, change speed, tr anscribe,music,music software, mac, macintosh, notation, guitar, keyboards,variable, variable speed, midi software,arpeggiator,harmonizer,compact disc,audio cd,sound, computer music,
multimedia softwa re,synthesizer,entertainment, edutainment, jazz, improvisation,sweet sixteen,roni music,windows |
| software, downer, amazing, changing, without, transcribe, frames, contents, inside, please, viewed, contents, wanting, available, musicians, intended, windows, computers, browser, ability, viewing |
ronimusic.com - rank der domain 991397 (406282 in US)
|
|
| zum Seitenanfang ↑ |
| Beatlock Technology |
| Welcome to Beatlock Technology |
| http://djmixpro.com/beatlock.html |
| DJ Mix Pro is the ideal DJ mixing program for parties and nightclubs or just background music. Desig n mixes on headphones while music is playing on speakers. |
| |
| |
| padding, border, 99ffff, center, background, beatlock, technology, computer, welcome, science, techn ology, digital, believe, beginning, counting, mixing, interested, products, determining, pioneer, ge neva, helvetica, sunsans, visited, ccccff, active, bottom, regular, 303030, family |
djmixpro.com - rank der domain 969140 (0 in HK)
|
|
| zum Seitenanfang ↑ |
| Computers/Software/Shareware/Windows/Multimedia/Music_and_Audio |
|
|
| Computers/Software/Shareware/Windows/Multimedia/Music_and_Audio |
| zum Seitenanfang ↑ |
| JukeBytes 1.0 |
| JukeBytes is now FREEWARE! |
| http://www.jukebytes.00go.com/ |
| JukeBytes is a program to have all .m3u and .pls playlist inside a jukebox simulator. |
| |
| |
| freeware, jukebytes |
00go.com - rank der domain 869276 (355122 in US)
|
|
| zum Seitenanfang ↑ |
| Polyhedric Software |
| Polyhedric Software |
| http://www.polyhedric.com/software/ |
| Maker of the Acid WAV sound editor and synthesizer. WAVmaker, MIDI to WAV renderer. |
| |
| Ace of WAV,Acid WAV,Cool Edit,Goldwave,Sound Forge,WAV,WAVs,sound editor,wav editor,wav files,wav to mp3,WAV player,CD to WAV,synth,synthesizer,software synth,soft synth,soft synthesizer,virtual synth ,analog synth,synth samples,synth emulator,vocoder,Cylonix,samples,sampling,free samples,sound sampl es,music samples,drum samples,audio samples,wav samples,sampling,sound,edit,editor,effect,sound effe cts,digital audio,record,DAW,multimedia,music,filter,sound card,Sound Blaster,sound effects,sound fi les,sound clips,sound recorder,audio browser,spectral analysis,spectrum,audio,sound |
| polyhedric, software, polyhedric, editor, midinight, mellosoftron, express, wavetable, without, reco rding, official, gsound, webmaster, general, library, quality, latency, engine, virtual, programs, t ables, sampler, wavmakertm, digital, playback, chains, effect, programmable, rendering, announce, an nouncement, releases, consulting, notified, formerly, sampler, instrument, expresstm, mellosoftrontm , opendsp, simply, synthesizer, windows, wavetable |
| (SLD : polyhedric.com) |
|
| zum Seitenanfang ↑ |
| Cybercorder 2000 |
| Skyhawk Technologies - Cybercorder 2000 Audio Recording
Software |
| http://skyhawktech.com/ |
| Provides VCR like recording for radio shows or any audio input. Recordings are stored on disk with o ptional audio compression to save disk space. |
| Cybercorder 2000 provides VCR-like recording for radio shows or any audio input. Recordings are stor ed on disk as WAV or MP3 files with audio compression to save disk space. |
| audio recording software, mp3, mp3 recorder, mp3 recording, audio recording, audio recorder, audio s oftware, radio, radio station, live radio, live radio broadcast, multimedia software, news radio, sp orts radio, radio broadcasts, radio live, radio show, radio software, recorder, recording, recording software, talk radio, am radio, fm radio, shareware software, sound, sound card, sound file, sound recorder, sound recorder software, sound wave, sound wavs, wav, wav sound, wave file, wave recorder, wave sound, wave sound file, vcr |
| cybercorder, record, easily, window, customized, playback, recordings, output, features, connect, si mply, advance, completed, various, reverse, computer, source, recording, forward, purchase, download , support, privacy, contact, screen, features, technologies, skyhawk, recording, software, played, i nternet, recordings |
| (SLD : skyhawktech.com) |
|
| zum Seitenanfang ↑ |
| DJ Jukebox |
| DJ Jukebox - Music Library Management Software |
| http://www.gammadyne.com/jukebox.htm |
| Playlist generator and media file manager that supports remote control through a LAN. |
| DJ Jukebox is a playlist generator and song library manager. |
| dj playlist, jukebox, jukebox software, playlist generator, dj software download, playlist generator s, mp3 playlist generator, dj playlist software, juke box |
| jukebox, disabled, server, playlist, rating, download, playlists, features, commercials, chosen, fea ture, button, remote, commands, generated, automatically, player, installation, purchase, additional , remotely, library, ensure, number, generates, supports, gammadyne, assigned, entertainment, delete d, remote, control, network, located, ratings, complete, management, download, control, renamed, pur chase, played, easily, license, please, limitations, generate, artist, average, favorites, approxima tely |
gammadyne.com - rank der domain 579933 (249785 in US)
|
|
| zum Seitenanfang ↑ |
| CrusherX-Live |
| accSone - audio - video - network software development - crusherX-Live! |
| http://www.crusher-x.de/ |
| Sound synthesizer with vapor algorithm that creates very complex sounds in real time. Features MIDI and force feedback controls. |
| accSone - audio - video - network software development |
| accSone, Stelkens, crusher-X, syncmaker, peersynth, crusherX-Live!, crusherX-Live! About, Requiremen ts to run crusher-X, crusherX-Live!, crusherX-Live! About, Videos, crusherX-Live!, crusherX-Live! He lp - About, About crusherX-Live!, crusherX-Live!, crusherX-Live! Help - About, About crusherX-Live! |
| crusherx, granular, accsone, synthesizer, crusher, synthesis, guitar, sounds, software, network, dev elopment, controller, fender, ac30cc1, effect, example, running, connected, sample, 1008ha, vintage, standard, soundcards, algorithm, platforms, interface, newbie, engine, american, special, factory, modelling, requirements, videos, videos, directx, system, picture, resolution, application, enables, synthesize, algorithm, powerful, download, history, license, opinions, englishdeutsch, download, su pport |
| (SLD : crusher-x.de) |
|
| zum Seitenanfang ↑ |
| Computers/Software/Shareware/Windows/Multimedia/Music_and_Audio |
|
|
| Computers/Software/Shareware/Windows/Multimedia/Music_and_Audio |
| zum Seitenanfang ↑ |
| Tray Transpose Tool |
| Tray Transpose Tool from Split Infinity Music |
| http://www.simusic.com/traytranspose.html |
| Program that will work with any Windows application to transpose chords into any key. |
| Tray Transpose Tool is a small quick Windows application that helps you transpose chords quickly and easily. This new version supports rich text to and from the Windows clipboard, has support for Lati n/Spanish and Jazz/Nashville style chords, and many new features. |
| transpose, song, praise, worship, worship leading, transpose, transposition, transposing, shareware, public domain, demo, Windows, tray, system tray, nashville, latin, spanish, jazz, chord |
| transpose, transposed, support, clipboard, windows, different, unlocked, nashville, styles, worship, chords, supports, spanish, download, system, purchase, functions, infinity, application, syntax, ch ords, guessing, highlighting, automatic, comprehensive, optional, capabilities, transposition, print ing, projection, playlist, formatted, including, planning, instant, recognition, databasing, checkin g, expanded, features, transposition, improved, features, worship, purchasing, product, copied, inte ntionally, information, button, 3182594 |
| (SLD : simusic.com) |
|
| zum Seitenanfang ↑ |
| Loop Recorder |
| Loop Recorder: Sound Recording Software for Windows: Record anything anytime |
| http://www.looprecorder.de/ |
| Designed for capturing songs from the radio. The loop mode infinitely records up to a specified numb er of minutes in a continuous loop while scrolling the data. |
| Loop Recorder is ideal for capturing songs from the radio. Never miss the beginning of a song ever a gain! Simultaneous recording, previewing and saving, scheduled recording, MP3-support, ... |
| |
| windows, record, anything, anytime, software, recorder, recording |
| (SLD : looprecorder.de) |
|
| zum Seitenanfang ↑ |
| Depopper |
| DePopper |
| http://www.droidinfo.com/software/depopper/ |
| Software to get almost CD quality from vinyl disks. Minimizes clicks, scratches and noise without re moving treble sounds. |
| DePopper is the first low cost vinyl restoration program that really works. Only US. 30 days free evaluation. |
| noise,vinyl,restoration,clicks,hiss,declicker,dehisser,depopper,quality,audio,pops,restauration,scra tches,sound,wav |
| depopper, depopper, settings, clicks, records, evaluation, remove, version, download, privacy, downl oad, software, future, payment, interface, screens, better, during, server, depopsfx, presets, paypa l, respect, windows, impossible, sources, scratches, droidinfo, completely, people, powerful, regist er, register, button, licensing, version, windowstm, choose, equivalent, depopper, padfiles, webmast ers, doubts, special, options, certifications, ratings, charges, countries, informatica, actual |
| (SLD : droidinfo.com) |
|
| zum Seitenanfang ↑ |
| ACD-Gold Edition |
|
| http://www.ezetest.com/acd/acdgold.htm |
| Uses a special technique, called Compact Disc Digital Audio (CDDA), to read audio data from regular audio CDs. |
| |
| |
| |
| (SLD : ezetest.com) |
|
| zum Seitenanfang ↑ |
| Digalo TTS |
| Digalo - Smart talking multimedia applications portal |
| http://www.digalo.com |
| Text-To-Speech (TTS) engine in any of 8 languages for all speaking applications supporting SAPI or M icrosoft Agent. |
| Smart talking multimedia applications portal. Download speech-enabled software, and get your compute r talking to you ! |
| Text to speech, elan, TTS, speech, Text-to-Speech, synthesis, voice, synthetic, speech synthesis, sy nthesized speech, talking web, text to speech software, text-to-speech synthesizer, multimedia, pock et pc, sapi, reader, speech application, software, application, mac, Linux, unix, PC, StrongARM, MIP S, SH3 |
| acapela, speech, digalo, applications, sparkling, acapela, talking, longer, empowering, innovations, solution, provided, reader, websites, textaloud, voices, quality, convenienceware, online, experien ce, please, pleasant, result, developed, partners, natural, laboratory, several, establish, created, portal, multimedia, 2084875, switch, urchintracker, helpful, talkative, launched, recently, friends , contacts, shared, solutions, tremendous, experienced, capabilities, initiative, changes, player, i nnovative |
| (SLD : digalo.com) |
|
| zum Seitenanfang ↑ |
| XGPad |
| XGPad Home - Yamaha SW1000XG - XG Editor |
| http://www.xgpad.com/ |
| Software editor for the Yamaha SW1000XG sound card and all other XG sound cards like the DB50XG, SW6 0XG, MU10, MU50, MU80, MU100, MU128, QY70, QY700, and others. On screen keyboard to audition sounds and set keyboard splits. [Windows95/98/2000/NT] |
| The XGPad software editor for the Yamaha SW1000XG sound card and other XG sound systems like the DB5 0XG, SW60XG, MU10, MU50, MU80, MU90, MU100, MU128, QY70, QY700, CS1x, CS2x, PSR-Keyboard series, CVP series etc. |
| XGPad, SW1000XG, Yamaha, PLG150AN, PLG100DX, PLG150DX, PLG100VH, PLG150PF, PLG100VL, XG, XG, XG, Ken ton Plugstation, DB50XG, SW60XG, MU10, MU50, MU80, MU90, MU100, MU128, QY70, QY700, QS300, CS1x, CS2 x, PSR, CVP, synth, synthesizer, editor, music, studio, audio, direct to disc, redording, Cubase VST , cakewalk, cubase, logic, logic pro audio, midi, midi, midi, Michael Bray |
| family, plugstation, sw1000xg, nounderline, weight, kenton, revised, yamaha, randomise, editor, load ing, height, calculator, margin, saving, selection, helvetica, visited, smaller, header, decoration, support, sequence, player, plg150pc, graphical, copyright, windows, response, portamento, analogue, monitor, visual, options, labels, interface, function, import, xgedit, rotary, reduced, plg150pf, p rogram, action, analogue, improved, editable, channel, smaller, bottom, 999933 |
| (SLD : xgpad.com) |
|
| zum Seitenanfang ↑ |
| Virtuosa Phoenix Edition |
| Virtuosa FREE Download, the best music & movie jukebox to rip, play, automix, organize, visualize, convert, normalize, burn music and to view, organize and enjoy movie files ! |
| http://www.virtuosa.com/ |
| The most visual, scalable and user-friendly music and movie jukebox on the planet. It is an all-in-o ne solution to transfer, organize and enjoy audio and video files. |
| FREE Download: Virtuosa Phoenix Edition is a spectacular all-in-one music and movie software jukebox to rip, play, automix, organize, visualize, convert, normalize, burn and enjoy all standard audio f iles and to view, organize and enjoy all standard video files on your computer. Includes free trial download of the music and movie jukebox. |
| rip play playlists automix organize visualize convert normalize burn virtuosa.com virtuoso new all-i n-one music and movie jukebox free MP3 player organize playlists divx audio and video collection con vert music tracks mp3 to wav encoding wave to mp3s conversion mp3 to wma converters wma to mp3 conve rters audio encoders CD rippers red book CD burning free mpegs free divx player movie jukebox music juke box divx juke-box Mp3 jukebox virtuoso music player virtuosa phoenix edition music download lif etime license citymusic music city np3 wma div-x CD midi mpeg WMV Avi MP2 MPEG m3u Aiff snd Adpcm Do lby AC3 Ogg Vorbis Mod p2p peer-to-peer Kazaa Morpheus Napster Overnet Freenet |
| 153188, urchintracker, tracks, quality, virtuosa, organize, automix, languages, english, numbers, ha ndled, correctly, settings, compatible, acceleration, encoding, encoder, plugin, installer, french, update, silver, company, copyright, contact, updates, reserved, worldwide, rights, funvibes, version , importing, ripping, german, spanish, latest, install, italian, import, convert, superior, organize , windows, transparent, visualize, standard, jukebox, download, visualize, convert, normalize |
| (SLD : virtuosa.com) |
|
| zum Seitenanfang ↑ |
| CD-Runner |
| |
| http://www.cdrunner.com/ |
| Designed to automatically identify and play media of all types, from CD to MP3. It also rips audio C D tracks, converts WAV to MP3, creates MP3 ID3 tags, and automatically downloads CD information from the CDDB over the Internet. [Win95/98/Me/NT/2000] |
| |
| |
| |
| (SLD : cdrunner.com) |
|
| zum Seitenanfang ↑ |
| HyCD Play and Record |
|
| http://www.hycd.com/html/play_record.htm |
| Offers CD recording, MP3 encoding, and audio CD playback features, as well as plug-in support. [Win9 5/98/Me/NT/2000] |
| |
| |
| |
| (SLD : hycd.com) |
|
| zum Seitenanfang ↑ |
| DART CD-Recorder |
| DART - Digital Audio Restoration Technology |
| http://www.dartpro.com/products/DartCDRecorder.asp |
| Captures music on the computer hard drive, organizes and converts files, and burns CDs. [Win95/98/Me /NT/2000] |
| DART Allows you to record and restore any type of music and then create CD's right from within the p rogram. The best audio restoration tool available today. |
| dart,dart pro 32,dart pro 98,cd-recorder,CD-R,CD-RW,CD-r's,recorders,burners,rippers,music,restorati on,audio,mp3,mp-3,mp3's,midi,cleanup,songs,artists,record,save,restore,recorder,pro,32,98,digital,te chnology,33,45,78,rpm,cassette,cassettes,lp's,8 track,stereo,mono,turntable,tapedeck, audio restorat ion, music restoration,declick,de-click,dehiss,de-hiss,denoise,de-noise,crackle,pop,removal,hiss,cli cks, |
| quality, tracks, recording, restoration, technology, control, playlists, automatically, digital, rec order, sweeten, clicks, identifies, artist, option, information, proven, declick, removes, dehiss, s cratches, normalize, setting, volume, comparative, equalizer, display, levels, individual, freedb, b uffer, protection, longer, minute, optimization, allows, simulate, coaster, errors, player, joliet, played, support, optional, recording, session, overburn, spacing, unique, players, master |
| (SLD : dartpro.com) |
|
| zum Seitenanfang ↑ |
| Wave Corrector |
| Wave Corrector: Process Vinyl Records and Tapes |
| http://www.wavecor.co.uk/ |
| A true WYSIWYG waveform corrector to automatically removes clicks and hiss from vinyl and tape/casse tte recordings and divides album files into separate CD track files. |
| Wave Corrector, Windows software to declick and dehiss vinyl and tape recordings for transfer to CD. |
| vinyl to cd, lp to cd,vinyl,record,transfer,cdr,cd-r,lp,declick, dehiss,de-click,de-hiss,denoise,noi se reduction,noise removal,ganymede,audio wave,corrector,click removal,denoise,click,editor,software ,shareware |
| corrector, corrections, program, edition, professional, clicks, window, remove, corrected, correctio n, allows, features, digital, provides, uncorrected, individual, adjusted, recording, recordings, re cords, quality, tracks, boundaries, oscilloscope, editor, automatically, processing, waveform, follo wing, option, algorithms, optimise, frequency, manually, pagetracker, original, process, display, ma terial, interface, available, control, recordings, united, underlying, colour, manual, product, prod ucts, correction, ganymede |
| (SLD : wavecor.co.uk) |
|
| zum Seitenanfang ↑ |
| MixVibes |
| Mix MP3 - Best DJ Software - MixVibes |
| http://www.mixvibes.com/ |
| A DJ program, which includes a mixer, virtual CD player, equalizer, and sound effects generation. Al l sound formats are supported, including MP3 and WAV. [Demo] |
| |
| best dj software, best, dj, mix, mp3, software, dj software, mixvibes, mix vibes, dj gear, dj mix, d isk jockey, dvs, bpm, turntable, crossfader, mixer, scratch, music, master tempo, beat, beat matchin g, vinyl, loops, auto mix mp3, timecode, timecoded vinyl, recording, pitch, turntables, beat, virtua l dj, digital dj, mixing, dj mix, mp3 mixer, dj mix software, mixvibes pro, mixvibes dvs, mp3 dj, dj mix program, mix software, blog, logiciel dj, meilleur logiciel dj, mixer, mixe, logiciel, logiciel dj, meilleur logiciel dj, video, video mix |
| mixvibes, software |
mixvibes.com - rank der domain 346287 (136065 in US)
|
|
| zum Seitenanfang ↑ |
| NoteWorthy Composer |
| NoteWorthy Composer - MIDI Music Composition and Notation Processor Software |
| http://www.noteworthysoftware.com/composer/ |
| Software music composition, and notation processor, to create, record, edit, print, and play back mu sical scores. (Win95/98/Me/NT/2000) |
| |
| |
| middot, noteworthy, composer, notation, editor, keyboard, performance, support, display, played, com puter, transpose, allows, record, standard, external, feature, setting, printing, import, create, wi namp, existing, processor, upgrade, automatically, polish, software, browser, standard, shared, anot her, wizard, contained, others, converted, format, transpose, export, listen, rearrange, exported, i nteractive, format, several, application, viewer, embedding, designer, action, teachers |
noteworthysoftware.com - rank der domain 565654 (252882 in US)
|
|
| zum Seitenanfang ↑ |
| MixMeister Technology, LLC |
| MixMeister Technology MixMeister |
| http://www.mixmeister.com |
| Creates software tools for playing, producing and performing music mixes. |
| Create custom party mixes, burn CDs, or add special effects to MP3s with this line of DJ software fo r the novice and pro. Offers free trials and user community. |
| DJ, DJ software, MP3, MP3 software, MP3 dj software, dj mp3 software, mp3 mix software, mix, beat mi x, dance mix, MixMeister, BPM Studio, PCDJ, PC DJ |
| mixmeister, mixmeister, upgrade, express, studio, software, reviews, converter, copyright, reserved, rights, product, registration, policy, privacy, support, fusion, downloads, products, support, comm unity, company, expressinstall, swfobject, technology, registerobject, homepageflash, reviews, inter national, magazine, scammed, control |
mixmeister.com - rank der domain 307577 (127857 in US)
|
|
| zum Seitenanfang ↑ |
| SoundFaction |
| SoundFaction - Alive |
| http://www.soundfaction.com/alive/ |
| Alive is a graphical Soundfont editor for Creative Labs Soundfont compatible devices. Program provid es editors for synthesizers like the Korg Prophecy and the Creative Labs SBLive range. [Windows 95/9 8/ME/NT/2k] |
| Soundfaction makers of Progenie and the Alive SoundFont editor is a sound font editor for Windows 98 NT and 2k |
| soundfont sound font editor midi Windows music wavetable awe sf2 sbk SBLive demixing Alive Prophecy Korg Progenie |
| soundfont, soundfonts, windows, cakewalk, compatible, livesynth, presets, search, samples, editor, b efore, soundfont, librarian, browse, audition, easier, program, software, liveupdate, compatible, de vice, edition, demixing, creative, editor, support, pagetracker, please, internet, vienna, enable, q uicker, registration, options, recommend, enough, document, useful, fantastic, installation, install ed, gajshost, higher, pentium, version, downloading, 800x600, display, drivers, auditioning, audigy |
| (SLD : soundfaction.com) |
|
| zum Seitenanfang ↑ |
| Advanced WMA Workshop |
| Convert WMA to MP3 with our WMA to MP3 converter |
| http://www.litexmedia.com/ |
| Encodes WAV, MP3 and OGG files to WMA (Windows Media Audio) format, and decodes WMA to MP3, OGG and WAV format with ID3Tag v2 support. CD to WMA also supported. |
| |
| wma to mp3, wma to mp3 converter, wma mp3 converter, wma decoder, wma encoder, mp3 decoder, cd rippe r, cd to mp3, wma encoder decoder, wma encoder/decoder, wma converter, convert wma to mp3, wma to wa v, advanced wma workshop, mp3 converter, mp3 to wav converter, mp3 to wave converter, mp3 to m4a, wm a to m4a |
| released, changes, download, converter, workshop, advanced, youtube, protected, grabber, support, fo rmats, conversion, format, recorder, interface, software, converter, useful, supported, computer, co nvert, player, recording, complete, videos, studio, ripper, directly, acoustica, create, custom, con verting, embedded, search, conversion, single, wizard, favorite, features, convert, feature, importi ng, detection, fading, mixing, affiliates, management, compilation, squeeze, features, labels |
litexmedia.com - rank der domain 835422 (293870 in US)
|
|
| zum Seitenanfang ↑ |
| leafDrums |
| leafdigital leafDrums -
software drum machine |
| http://www.leafdigital.com/software/leafdrums/ |
| Shareware drum machine for Windows. Clear, simple interface. Can use any standard WAV file as a drum sound. Includes audio processing, and various digital effects. |
'text/html;charset=UTF-8' http-equiv='Content-Type' />leafdigital.com - rank der domain 999990 (430026 in US)
|
|
| zum Seitenanfang ↑ |
| Any Recorder |
| FastDomain.com: This website is temporarily unavailable |
| http://www.zj-fountain.com/recorder/ |
| Sound recording program, that records sound generated, or requested, by other computer programs. It can also convert wav files to mp3 format. |
| |
| |
| website, pagetracker, center, padding, margin, document, unavailable, temporarily, protocol, additio nal, location, information, contact, possible, gajshost, suspended, icesunsoft, individual, trackpag eview, initdata, gettracker, 9156498, border, pagecentered, fastdomain, 333333, thelink, 0000ff, bac kground, ffffff, please, please, trying |
| (SLD : zj-fountain.com) |
|
| zum Seitenanfang ↑ |
| MidiRunner |
| '+' |
| http://web.tiscali.it/midirunner/ |
| Integrated Play Center for MIDI, MP3, Wave, CD-Audio files and all others WindowsMedia supported sou nd files. Can also be used to create, edit and load playlists. |
| |
| MidiRunner,123Tag,AudioSlimmer,ABCPix,windowsmedia,MP3,MIDI,jukebox,audio,converter,tag,rename,audio 8,msaudio8,wm8eutil,player,video,viewer,wav,mpeg |
| target, download, details, registration, reviews, awards, location, document, onclick, function, par entnode, filename, frames, 123tag, abcpix, relink, nodename, midirunner, release, tiscali, banner, c lassname, search, rescan, viewer, videos, images, quality, chiamato, easiest, contact, audioslimmer, jukebox, setinterval, length, amazing, format, create, regexp, accompaniments, converting, srceleme nt, shareware, window, affordable, farinelli, alberto, italiano, midirunner, rename, shortuserdir |
tiscali.it - rank der domain 1532 (23 in IT)
|
|
| zum Seitenanfang ↑ |
| 2nd Speech Center |
| Text To Speech with Natural Voices |
| http://www.zero2000.com |
| Text-to-speech and text-to-mp3/wav software. |
| Text To Speech/Text To MP3/Text To WAV with Natural Voices |
| text to speech, text to speech software, text to speech voice, convert text to speech, text to mp3, voice mail, assistive technology, dyslexia, reading disability, esl, audiobook, ebook, ebook reader |
| speech, center, catalog, microsoft, expert, download, speech, explorer, contact, voices, interface, internet, documents, player, collection, advanced, powerful, talking, features, voices, dozens, fami liar, folders, allows, purchase, technology, executable, protect, natural, utility, authorized, spok en, execution, options, copyright, hierarchical, extensive, search, capabilities, combined, folder, categories, selected, characters, descriptions, 645324, reasonable, urchintracker, necessary, withou t, inserting |
zero2000.com - rank der domain 973141 (398026 in US)
|
|
| zum Seitenanfang ↑ |
| dRhumba |
| dRhumba - Software Drum Machine |
| http://www.drhumba.com/ |
| Software drum machine. Use it to load and sequence sound samples into measures and songs. It support s WAV and Ogg Vorbis files, exports to WAV. Information, screen shots, download, and registration. |
| dRhumba - Software Drum Machine |
| dRhumba, drum, drums, sample, samples,
sequencer, electronic, music, dance, audio, sound, ogg, v orbis, wav, mp3 |
| drhumba, samples, download, examples, screen, information, fraction, installer, flexible, machines, easier, listen, please, hardware, browse, organize, welcome, powerful, software, contact, register, software, machine, machine, features, associated, measures, allows, memory |
| (SLD : drhumba.com) |
|
| zum Seitenanfang ↑ |
| Advanced Sound Recorder |
| Sound Recorder: Advanced sound recorder and editor! |
| http://www.soundrecorder.net/ |
| Record and edit sound from microphone, streaming audio, media player, and games. [Windows 98/ME/NT/2 000/XP] |
| Advanced sound recorder: audio recorder, sound recorder, internet streaming recorder, wav recorder. |
| mp3 recorder, sound recorder, audio recorder, wav recorder, mp3 record, record mp3, record wav, reco rd sound, wav record, mp3, wave, sound, audio, record, recorder, mp3 recorder |
| recorder, advanced, recording, record, recording, supports, activation, recorder, parameters, system , powerful, support, feature, desire, recordings, copying, cutting, certain, features, signal, silen ce, amount, pasting, employing, hotkey, default, choose, enables, various, segments, effects, useful , silent, passages, trimming, windows, automatically, detect, played, streaming, complete, editor, p erformance, player, possible, application, formats, schedule, support, system, interface |
soundrecorder.net - rank der domain 971122 (415879 in US)
|
|
| zum Seitenanfang ↑ |
| PolderbitS |
| Download sound recorder, save cassette to cd & lp to CD, record what you hear |
| http://www.polderbits.com/ |
| Audio recording and editing software, or copy sound source to CD. Also creates MP3 files of recordin gs to play on PC or portable player. |
| PolderbitS Sound Recorder; the Easiest way to save your cassette tape and LPs to CD or MP3 and recor d what you hear. Download your unlimited trial today! |
| cassette to cd,lp to CD,Sound Recorder Download Free,free mp3 converters,Sound Wavs,transfer vinyl r ecords to cd,Transfer Vinyl Records To Cd,download sound recorder,Download sound recorder,free audio recording software,free audio editing software |
| function, document, tracker, script, analytics, google, download, getelementsbytagname, nederlands, location, protocol, parentnode, getasynctracker, window, return, english, insertbefore, polderbits, pbcrossdomainlink, getlinkerurl, javascript, setaccount, 371184, setdomainname, record, polderbits, setallowlinker, createelement, recorder, cassette, setallowhash, setdetectflash, trackpageview |
polderbits.com - rank der domain 859886 (372008 in US)
|
|
| zum Seitenanfang ↑ |
| djDecks |
| djDecks - Professional mp3, ogg, wma and wav dj mixing software |
| http://www.djdecks.be/ |
| Computer mixing program to mix MP3, ogg and WAV files. Features; a 3-band equalizer, loops, echo, be at detection, flanger, compressor/normalizer and cue-points. Manual includes a systematic guide. |
| |
| |
| djdecks, feature, controllers, version, download, complete, mixing, document, windows, documentation , hardware, includes, external, location, gajshost, experiences, pagetracker, offers, register, comm ents, special, updates, brings, support, advanced, controller, playlist, improvements, record, effec ts, registration, create, download, information, function, hercules, console, vestax, behringer, ana log, instead, displayed, filename, controlled, contains, definitely, rights, timecoded, plugins, dig ital, advantages |
djdecks.be - rank der domain 754062 (1700 in BE)
|
|
| zum Seitenanfang ↑ |
| Audio 4 Fun |
| Voice Changer and free Audio/Video software - Parody Voice Maker, DVD/MP3 Player, Music Editor & Free Screensaver |
| http://www.audio4fun.com/ |
| Products include voice changer software, and music, video and webcam morphers. |
| Voice Changer Software, change your voice for Voice-Over. Free download Audio/Video Software - MP3 P layer, DVD Player, Music Editor & Free Screensaver |
| voice changer, mp3 player, dvd player, free screensaver, audio video software, webcam software, chan ger voice software, music editor |
| player, screensaver, editor, parody, changer, software |
audio4fun.com - rank der domain 85890 (31805 in US)
|
|
| zum Seitenanfang ↑ |
| Audio CD Burner |
| Audio CD Burner: Virtual CD Burner converts DRM protected iTunes M4P to MP3, M4B to MP3, iTunes to WAV, M4A to WMA |
| http://www.audio-cd-burner.com/ |
| Create audio CDs from MP3 collection or WAV files. Product specifications, screenshots, FAQs, and do wnloads. |
| Audio CD Burner: Audio CD Burner, M4P to MP3 Converter easily converts DRM protected iTunes m4p to m p3, m4a to mp3, wma to mp3, m4b to mp3 and various audio files to unprotected MP3, iPod and other MP 3 player file formats at high speed and with CD quality. |
| |
| burner, protected, converter, virtual, convert, converting, unprotected, player, itunes, burning, vi rtual, formats, windows, purchased, converts, process, software, player, tracks, easily, supports, c onverter, version, higher, format, collection, normal, faster, download, ripping, napster, computer, cannot, programs, erasable, conversion, automatically, control, almost, emulates, options, recordin g, requirements, features, tricks, features, mobile, protection, burner, quality, artist |
| (SLD : audio-cd-burner.com) |
|
| zum Seitenanfang ↑ |
| FairStars Soft |
| Audio Converter, Recorder and Free CD Ripper with WMA MP3 AAC M4A AMR OGG FLAC APE etc support |
| http://www.fairstars.com/ |
| Professional audio software products with ease-to-use features, including sound recorder, and audio converter. Supports a variety of formats. |
| audio recorder,audio converter, free cd ripper and ID tag editor software, offers professional featu res with WAV, RM, RA, RMJ, RAM, RMJ, RMVB, AC3, DTS, AIF, AIFF, AIFC, AU, Creative VOC, PVF, PAF, IF F, SVX, APE, FLAC, OGG, VQF, MP1, MP2, MP3, MP4, M4A, M4B, AAC, AMR, AWB, WMA, WMV, ASF formats supp ort. |
| audio converter, music converter, sound converter, audio recorder, sound recorder, music recorder, r ecord from soundcard, record from micphone, free cd ripper, wma mp3 ape wav flac recorder, rm to mp3 , rm mp3 converter, convert rm to mp3, ra to mp3, aac to mp3, decoder, encoder, wma converter, vista recorder, RM, RA, RAM, RMJ, RMVB, AC3, DTS, AIF, AIFF, AIFC, AU, Creative VOC, PVF, PAF, IFF, SVX, APE, FLAC, OGG, VQF, MP1, MP2, MP3, MP4, M4A, M4B, AAC, AMR(AMR-NB + AMR-WB), AWB, WMA, WMV, ASF, MP 4 Audio, ALAC |
| fairstars, converter, recorder, download, support, formats, features, conversion, download, screensh ots, released, recording, temporary, include, format, products, ripper, convert, without, includes, fairstars, addition, program, volume, including, realmedia, normalization, creative, support, regist ration, contact, directly, update, version, function, recorder, streaming, additional, contact, dete ctor, anything, dialogs, movies, sounds, performed, allowing, conversions, player, speeds, settings, professional |
fairstars.com - rank der domain 923597 (401116 in US)
|
|
| zum Seitenanfang ↑ |
| PowerKaraoke |
| Karaoke Software, Karaoke MP3 - Burn, Create, Play, Convert and Copy CD+G Discs, Video Karaoke Songs |
| http://www.powerkaraoke.com/ |
| Software to create, play, burn, and copy CD+G and video karaoke. Also offers converter tools for var ious formats, including MIDI. |
| Karaoke Software, Karaoke MP3 - Burn, Create, Play, Convert and Copy CD+G Discs, Video Karaoke Songs |
| karaoke, karaoke software, karaoke mp3, karaoke pc software, computer karaoke players, karaoke playe r software |
| karaoke, karaoke, software, create, creator, converter, burner, player, create, windows, computer, s iglos, convert, player, convert, change, process, professional, available, download, support, produc ts, filter, frequently, recorder, players, compatible, software, professional, samples, mailing, sup port, easier, please, question, hundreds, program, unique, formats, supported, include, regular, dev ices, customer, background, videos, portable, mobile, satisfaction, movies, replacing |
powerkaraoke.com - rank der domain 155521 (60332 in US)
|
|
| zum Seitenanfang ↑ |
| WAVChop |
| Split WAV Files WAVChop Software |
| http://www.matthewssoftware.com/WAVChop/ |
| Split gigabyte size WAV sound files into smaller WAV files where silent pauses are detected. |
| Split WAV files with WAVChop, a program that lets you automatically chop up a WAV sound file into pi eces where silence is detected. |
| Split WAV, File Split WAV, Silence Detection |
| wavchop, smaller, gigabytes, program, windows, recording, programs, maximum, computer, pieces, follo w, processing, searches, starts, beginning, installation, pauses, install, splits, itself, during, s ilent, amount, appear, gigabyte, instruction, memory, uncompress, significant, chopping, simply, cre ate, system, operating, formats, supported, largest, usually, executable, easily, original, deleted, download, modified, monitor, automatically, record, button, quickly, select, favorites |
| (SLD : matthewssoftware.com) |
|
| zum Seitenanfang ↑ |
| DanDans Software |
| Audio MP3 Editor Software, Music Editor Software - DanDans Digital Media |
| http://www.dandans.com/ |
| Audio and Internet software, such as MP3 CD Ripper, and IP Sniffer download trial versions. |
| Audio MP3 Editor, Music Editor, Video DVD Converter, Music Editing Software, Best Audio & Video Soft ware From DanDans Digital Media |
| audio editor, mp3 editor, music editor, audio edit, music edit, audio editing, music editing, cut au dio, merge audio, audio converter software |
| editor, formats, editing, dandans, popular, converter, master, editing, extractor, pagetracker, supp orts, gajshost, document, quality, software, without, digital, visually, software, inside, changing, password, revealed, hidden, encrypted, already, records, personal, existing, support, copyright, in stead, remove, contact, javascript, script, analytics, trackpageview, 13007369, gettracker, google, library, download, reserved, rights, favorite, location, unescape, 3cscript, protocol, almost |
dandans.com - rank der domain 775355 (0 in US)
|
|
| zum Seitenanfang ↑ |
| CD Trustee |
| CD database software and CD catalog software automatically catalogs your CD music
collection and MP3 songs, and prints album covers, jewel case covers, and CD labels |
| http://base40.com/ |
| Automatically catalogs music collection by inserting each CD into your computer. Gathers song titles and album information, no typing needed. Prints jewel cases, CD labels and reports. |
| |
| |
| software, covers, prints, labels, catalog, database, automatically, catalogs, collection |
| (SLD : base40.com) |
|
| zum Seitenanfang ↑ |
| CoolSound KeyBoard |
| http://www.tomarogroup.com |
| http://tomarogroup.com/ |
| Easy to use musical keyboard that uses the mouse and cursor to play, choose from 128 different sound s. |
| |
| |
| script, tomarogroup, turned, location, turning, experience, microsoft, internet, appname, navigator, explorer, window, website, requires |
| (SLD : tomarogroup.com) |
|
| zum Seitenanfang ↑ |
| MIDIFixer |
| MIDI Volume Software MIDIFixer |
| http://www.matthewssoftware.com/MIDIFixer/ |
| Modify the dynamic range of a MIDI file, eliminate stuck notes, and change the speed. |
| MIDI Volume software MIDIFixer lets you edit volume levels in MIDI files. Normalize the volume. Also eliminates stuck notes. Also edit MIDI speed, MIDI tempo. |
| MIDI volume, stuck notes, MIDI stuck notes, MIDI volume equalize, MIDI volume equalization, MIDI vol ume equalizer, MIDI volume adjust, volume, velocity, automatic, electronic keyboard, volume normaliz e |
| midifixer, volume, volume, device, single, automatically, change, levels, dynamic, software, before, insert, commands, released, software, instruct, deutsch, uncompress, itself, executable, download, install, follow, appear, instruction, installation, english, otherwise, windows, completely, ranges, inappropriate, smooth, normalize, control, electronic, computer, change, noticed, modify, dynamic, increase, certain, encountered, program, updated, velocity, desired, settings, eliminate |
| (SLD : matthewssoftware.com) |
|
| zum Seitenanfang ↑ |
| Riptide Innovations |
| Turn your Computer into a Touch Screen Jukebox with Full Screen Mp3 Player Software |
| http://www.mp3touchscreens.com/ |
| With the combination of the TouchTone Audio System software and some low-cost hardware, average home users can learn how to transform their computer and music files into a high-tech, touch screen, mus ic (Mp3, OGG, WMA) jukebox. |
| The TouchTone Audio System is a full screen jukebox interface for the winamp mp3 player designed to turn your pc and music file collection - mp3 wav ogg and wma - into a touch screen compatible, high tech jukebox. Learn in five easy steps how to transform your pc into a touchscreen mp3 jukebox with the touchscreen add-on kit. |
| touch screen, interface, full screen, music jukebox, full-screen, free, touchscreen, jukebox, juke b ox, mp3s, mp3 player, mp3 players, music software, ogg, wma, wav, mp3, winamp, touch screen jukebox, touch-screen, digital music, audio, download, downloads |
| jukebox, screen, touchtone, system, software, screen, touchscreen, support, features, perfect, solut ion, magazine, riptide, jukebox, innovations, compatible, interface, monitor, addition, capabilities , computer, install, becomes, offers, multiple, playlist, levels, unlike, process, simple, logical, locating, unique, available, impress, however, completely, customizable, various, window, corner, av erage, impressive, select, options, although, properly, reserved, rights, urchintracker, 779608 |
mp3touchscreens.com - rank der domain 924460 (0 in US)
|
|
| zum Seitenanfang ↑ |
| Coyote Electronics |
| Coyote Electronics - Home |
| http://www.coyotes.bc.ca/ |
| Software for noise reduction and for repairing the sound from vinyl LP records and cassette tapes wi th de-hissing and track-splitting, and DirectX plugins for high-quality audio manipulation. Download s, FAQs, registration, and support. |
| |
| sound, groove mechanic, audio, hiss, hiss reduction, noise reduction, Click Removal, declick, dehiss , Groove Mechanic, repair, Declick, Dehiss, shareware, DirectX plugin, chorus, flanger, direct X, VS T, wah |
| coyote, mechanic, groove, plugins, directx, features, update, include, centrifuge, amplidude, releas es, version, removal, program, audioxpress, reviews, algorithms, expander, compressor, phaseone, com patible, chorus, pcrecording, software, quality, theurl, winname, including, offers, electronics, re cent, occurred, registration, windows, reviews, products, message, recent, downloads, magazine, avai lable, version, classic, removes, review, support, feature, requested, recording, reviewed, recently |
| (SLD : bc.ca) |
|
| zum Seitenanfang ↑ |
| CDmenu v3.0 |
| Sheilsoft.com - Software (CDmenu) |
| http://www.sheilsoft.com/software/cdmenu.htm |
| Fully customizable, CD front-end menu system to add background image, splash screen, and Wav sound. |
| |
| |
| cdmenu, software, sheilsoft |
| (SLD : sheilsoft.com) |
|
| zum Seitenanfang ↑ |
| n-Track Studio |
| n-Track Studio Multitrack Recording Audio Software |
| http://www.ntrack.com/ |
| Audio and MIDI multitrack recorder for Windows XP, ME, 98, 95, NT, 2000. Record and playback an unli mited number of audio and MIDI tracks. Support for VST instruments and DirectX instruments synth plu g-ins. Product overview, screenshots, FAQs, forum, and downloads. |
| audio multitrack recording and editing software for Windows with unlimited audio and MIDI tracks, vi rtual editing features, support for 24 bit multichannel soundcards, realtime effects and support for DirectX and VST effects and instruments. |
| multitrack recording, audio effects, audio recording, VST plugins, DirectX plugins, Rewire, digital audio recording, DSP, DAW, audio mixing, audio recording software |
| tutorial, youtube, myquotes, thequote, software, download, effects, decoration, tracks, classnounder line, rotatequote, handle, recording, studio, computer, program, document, because, tracklist, optio n, trouble, preparing, function, guitar, product, magazine, musician, electronic, editor, seconds, w aveform, record, encoder, internet, editing, overdub, clicktale, released, though, playback, intergr ated, ability, support, extensive, directx, grandmother, novices, professionals, functions, amount, finnbj |
ntrack.com - rank der domain 415216 (166536 in US)
|
|
| zum Seitenanfang ↑ |
| ExpStudio |
| Free Audio Editor, Free mp3 audio editor |
| http://www.expstudio.com/ |
| Audio editing tools to create, converter, and save audio files. Software descriptions, screenshots, and trial downloads. |
| Free sound editing program to edit wav, mp3 or other audio files. Can be used as a music editor, for editing audio files or a quick mp3 edit. It includes sound effects like.. amplify, normalize, equal iser, envelope, reverb, echo, noise reduction, and sample rate conversion and other effects. |
| music editor, music editing software, audio editing software,sound editor,audio editor,mp3 editing s oftware,wav editor,editing audio,mp3 editors,digital audio editor,wav edit,wave editor,mp3 edit,free audio editor,free sound editor, cool edit, audacity,wavelab,audacity com |
| filter, editor, expstudio, different, effects, waveform, format, silence, female, uncompressed, inse rt, another, selected, information, navigation, search, download, software, editor, formats, followi ng, supported, compressed, others, content, copyright, silence, convert, additional, homenewsdownloa dpurchasesitemapabout, xtremepower, artist, channels, information, change, marker, locate, special, comments, google, chinese, traditional, croatianczechdanishdutchestonianfilipinofinnishfrenchgalicia ngermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedo nianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahilis wedishthaiturkishukrainianvietnamesewelshyiddish, friends, rights, reserved, results, newspapers, bu ndled, others, simplified |
expstudio.com - rank der domain 946863 (408994 in US)
|
|
| zum Seitenanfang ↑ |
| AbyssMedia |
| Abyssmedia — MP3 Recorder, ScriptCryptor, AudioRetoucher, Quick Batch File Compiler |
| http://www.abyssmedia.com/ |
| Advanced audio software including recorder, converter, cd-ripper, editor and audio cd burner for MP3 , WMA and Ogg Vorbis file formats. |
| mp3 recorder, sound recorder, stream recorder, vbs to exe, bat to exe, msi to exe |
| mp3 recorder, sound recorder, mp3 converter, audioretoucher, quick batch file compiler, vbs to exe, msi to exe |
| compiler, recorder, download, record, siteinfile, burner, audioretoucher, scriptcryptor, windows, st reaming, formats, midirenderer, converter, recording, convert, converter, allows, popular, include, resources, protected, without, execution, specified, during, formats, abyssmedia, directly, applicat ion, additional, applications, description, encrypted, version, company, information, various, creat e, minute, quality, rendering, create, conversion, output, professional, custom, modified, instrumen t, composition, software, changes |
abyssmedia.com - rank der domain 243988 (100144 in US)
|
|
| zum Seitenanfang ↑ |
| All Editor |
| DVD Ripper, DVD Copy, avi Converter, mp3 converter, mp3 recorder, DVD Backup, CD Ripper, MP3 CD Maker. |
| http://www.alleditor.com/ |
| Audio editor with over twenty effects, records and save directly to MP3/WMA/OGG/VQF/WAV files. Produ ct specifications, screenshots, FAQs, tutorials, and downloads. |
| 1st Benison , mp3 wma ogg vqf wav solution provider |
| DVD Ripper, DVD Copy, Video Converter, mp3 recorder, sound editor, wma converter, CD Burner, CD Ripp er, DVD, mp3, DivX |
| |
| (SLD : alleditor.com) |
|
| zum Seitenanfang ↑ |
| All Recorder |
| MP3 recorder, WMA recorder, SWF Recorder record sounds to MP3/WMA/SWF |
| http://www.allrecorder.com/ |
| Record edit and save sound from microphone, games, Internet, Winamp, and quick time, into MP3, wma, ogg, vqf, wav without losing quality. |
| All Recorder, a powerful music studio records any sound to mp3,wma,swf,wav,vqf,ogg |
| mp3 recorder, sound recorder, wma recorder, mp3,wma, swf |
| recorder, recording, record, recorder, record, system, change, automatically, frames, recording, eff ects, inline, recorder, various, quality, choose, losing, signal, device, streaming, without, curren tly, bitrates, sample, resampling, support, special, control, silence, configured, enables, silent, supports, browser, display, double, activated, passages, parameters, useful, directly, editor, profe ssional, windows, feature, microphone, played, schedule, internet, format, sounds |
| (SLD : allrecorder.com) |
|
| zum Seitenanfang ↑ |
| BirdCage Software |
| JukeBox Tools, MP3 MP2 MP1 / Ogg Vorbis Encoder / Player, CD Ripper, CD to MP3 or Ogg, Wave to MP3 / OGG , OGG / MP3 Decode to Wav, ID3 / OGG Tagger all at BirdCage Software |
| http://www.birdcagesoft.com/index1.html |
| Programs for CD Ripping, recording, tagging, editing audio, LP ripping, decoding and encoding MP3, j ukebox playlist player, plus Albw /M3U splitter. [Win95/98/Me/NT/2000/XP] |
| CD MP3 ripper Wave Digital Audio Extraction ASPI, Wave to MP3 Encoding, Decode MP3 and MPEG Layer 3 Audio Compression to Wav Music and Tagger edit tag in ID3 |
| mp3, mp3z, cd, burn, click, right, right click, encode, napster, decoder, decode, napster alternativ e, gnutella, winmx, windows, XP, mp3towav, mp3 to wav, mp3towave, cdr, ripping, ripper, ripped, on t he fly, grabber, napster, audio gnome, decode, drag and drop, wave to mp3, wav to mp3, encoder, enco ding, encode, tag, tagger, tagging, match, id3, id3v2, id3v1, id3v1.1, cda, amp, software, sexy, aud io, juke, jukebox, free, free, cddb, cddb2, cd-rom, cdrom, record, wave, download, free, software, m usic, aspi, aspi32, aspi_me, adaptec, scsi, gnutella, decoda, encoda, mp, player, play, plylist, ply ,list, web, html, csv, excel, win95, win, win98, win2000, 2000, winNT, NT, Windows, Linux, Mac, BE OS, Win, Random play, shuffle play, auto play, DJ, mpeg, com, .com, mpeg1, mpeg2, layer3, mp4, mp5, mp6, mp7, mp8, mp9, media, lame, blade, bladeenc, ogg, vorbis, .ogg, .mp3, .wav, real, multimedia, s tream, burner, burning, scour, news group, usenet, free mpz, free mp3, m3a, m3u, ram, ra, wma, .wma, .m3u, .m3a, exchange, s |
| newurl, birdcage, software, location, software, decode, vorbis, jukebox, encoder, player, ripper, ta gger |
| (SLD : birdcagesoft.com) |
|
| zum Seitenanfang ↑ |
| XemiComputers Audio |
| Sound recorders for all occasions - Download audio solutions by XemiComputers |
| http://www.xemico.com/groups/audio/ |
| Audio Notes Recorder and Claudio are voice notes and sound recording programs that work from the sys tem tray. |
| Audio Notes Recorder and Claudio are two easy to use voice notes and sound recording programs with f eatures like different operating modes, recorded sound quality selection and export to WAV, MP3, OGG or EXE among others. |
| audio notes recorder claudio sound recorder recording voice import export wav mp3 minutes of meeting recorder ogg Vorbis ANR microphone mic wave summarize share discussion agenda editor compression co nference MMR xemicomputers xemico shareware software program |
| playback, recordings, recorder, screen, transcription, programs, recording, export, recording, progr am, support, scheduled, solutions, software, xemicomputers, making, editor, meeting, preloadimages, meetings, through, features, minutes, claudio, lectures, stereo, shortcuts, record, businessmen, exe cutives, lawyers, scientists, between, professors, differences, recorders, special, doctors, employe es, quality, students, capacity, pocket, freeware, enough, solution, little, charge, automatically, transcribing, special |
xemico.com - rank der domain 510785 (212808 in US)
|
|
| zum Seitenanfang ↑ |
| GuitarFX |
| Guitar FX: software effects processor, guitar distortion pedals, presets |
| http://guitarfx.net/ |
| Software to turning the computer into a guitar effects processor, includes effects and presets libra ry. Software overview, screenshots, and trial download. |
| |
| |
| hotlog, guitarfx, infinityads, document, guitar, effects, download, software, button, folder, paypop upscriptstart, distortion, distortion, cookie, enable, processor, presets, recomended, appropriate, bottom, installed, cursor, overdrive, crunch, celeron, escape, picture, pentium, sounds, presets, na vigator, several, through, filters, looking, further, stereo, complex, presets, reverb, flanger, exp ires, javaenabled, location, referrer, window, screen, typeof, 0e81a08c, security, undefined |
| (SLD : guitarfx.net) |
|
| zum Seitenanfang ↑ |
| Kazi Sound Recorder |
| 123 Cleaner:Online privacy software,erase my tracks,disk clean up Tool,cache cleaner,deleting cookie,cookie cleaner.audio mp3 sound recorder for recording audio from computer to MP3/WAV/ogg/wma. |
| http://www.zminsoft.com/ |
| Records sound generated, or requested, by other computer programs, sound is saved in WAV, MP3, VOX, and OGG files. Supports sampling settings. |
| 123 Cleaner:a powerful Internet Privacy and security software to erase cache,cookies, autocomplete m emory,index.dat ,replayer and mediaplayer playlist and more.Keep Your Surfing Private. |
| private, privacy,clean up,clean, remove, delete, erase, files, downloads, free, software,swipe,cach e,cookies,index.dat,web eraser,net eraser,history eraser,playlist,visited,website, URLs, realplayer , mediaplayer,internet, divx, history, private, private, download,free,password,how to |
| cleaner, cookie, computer, recording, recorder, software, welcome, tracks, online, cleaner, deleting , privacy, software |
| (SLD : zminsoft.com) |
|
| zum Seitenanfang ↑ |
| CD Blaster |
| ABF CD Blaster is a CD-RW burner and CD-ROM ripper in one program |
| http://www.abf-soft.com/cd-blaster.shtml |
| CD Burner and ripper in one program, supports popular audio formats (MP3, OGG Vorbis, WAV, WMA), can get CD disc information from freedb, and a built-in audio player. |
| ABF CD Blaster is a powerful and easy to use CD Burner and CD Ripper in one program. |
| abf, cd burner, cd ripper, cd, cd-r, cd-rw, cdrom, cd-rom, burn, rip, burner, ripper, writer, reader , burn, burn cd, clone cd, copy cd, write cd, make cd, rip, rip cd, create cd, cd drive, audio cd, v ideo cd, convert cd, cut cd, cd label, rewritable, writable, recordable, digital cd, cd file, disk, disc, cd disc, mp3 cd, wma cd, song, albom, author, music, side, track, lazer, laser, ADD, AAD, DDD, AAA, compact disk, compact disc, freedb, cddb, cda |
| blaster, registration, backup, player, program, players, program, outlook, database, freedb, archive , convert, information, version, purchase, details, automatic, download, played, create, record, dow nload, tracks, regular, collection, formats, popular, depending, 207293, process, received, manually , during, immediately, postal, available, urchintracker, ordering, transfer, either, credit, passes, system, otherwise, period, receive, delivery, envelope, support, copyright, settings |
abf-soft.com - rank der domain 998163 (422122 in US)
|
|
| zum Seitenanfang ↑ |
| WinKaraoke |
| WinKaraoke.com - Microsing WinKaraoke |
| http://www.winkaraoke.com/ |
| Karaoke and voice recording + lyrics on the home computer. Features include voice effects like the c ool hall reverb effect and equalizer. |
| |
| |
| winkaraoke, microsing, karaoke, recording, version, singing, download, software, brings, features, c omputer, lyrics, recorder, website, created, displays, copyright, contents, recorder, microsing, pro ducts, trademark, author, without, developer, experience, amazed, sounds, effects, performance, down loadsupportinfokaraoke, homepurchasefree, amazing, equalizer, effect, reverb |
| (SLD : winkaraoke.com) |
|
| zum Seitenanfang ↑ |
| RIP Vinyl |
| LP to CD transfer made easy with RIP Vinyl from Wieser Software Ltd |
| http://www.ripvinyl.com/ |
| Convert vinyl records, cassette tapes, and more to multiple digital formats. |
| RIP Vinyl allows you to record sounds from any source into CD-R ready WAV or MP3 files. Start trans ferring your LP collection to digital format today. RIP Vinyl makes LP to CD transfer easy |
| 78 RPM, LP CD Transfer, Transfer Cassette, Copy Cassette, Record LPs, Vinyl, Split Tracks, sermons c d, ministry sermons, spoken word |
| paypal, credit, listen, tracks, record, windows, cassettes, software, wieser, transfer, account, pla yer, details, payment, allows, records, podcast, program, create, easiest, residents, create, direct , cheapest, equipment, further, listed, mixing, methods, convenience, accept, podcasting, microphone , confirmation, process, trademark, registered, approximately, clicking, microsoft, corporation, cop yright, reserved, rights, policy, privacy, states, united, countries, purchase, method |
| (SLD : ripvinyl.com) |
|
| zum Seitenanfang ↑ |
| Easy Recorder |
| Sound recorder / audio recorder software: EasyRecorder- Directly save to mp3 file to save disk space! |
| http://www.easyrecorder.com/ |
| Record sounds generated, or requested, by another computer program. Option to record online audio co nversations, such as those on Internet Telephony. [Windows 9x/2000/ME/NT 4.0/XP] |
| Sound Recorder,EasyRecorder, record any sound from your computer,then save as mp3 or wav file -EasyR ecorder V5.5,Audio recorder. |
| sound recorder,audio recorder,sounds,recorders |
| record, windows, recorder, easyrecorder, sounds, directly, favorite, recorded, features, internet, c onversations, software, whether, through, business, telephony, format, streams, either, option, popu lar, saving, online, recording, support, manage, easily, hotkey, urchintracker, 373052, supported, c ompatible, future, reference, transposed, provide, version, safekeeping, advantage, efficient, losin g, quality, convert, internet, upgrade, without, version, resource, record, hotkey, control |
| (SLD : easyrecorder.com) |
|
| zum Seitenanfang ↑ |
| Yeware Inc. |
| mp3 wav converters, encoders, decoders, recorders, cd rippers, dvd rippers,burners, audio grabbers |
| http://www.yeware.net/ |
| Download CD Ripper, MP3 Decoder and Encoder software. |
| mp3 wav converters, encoders, decoders, recorders, cd rippers, audio grabbers MP3 CD WAV converter - MP3 converter, MP3 CD WAV, MP3 WAV CD, MP3 to WAV CD, CD WAV to MP3, MP3 CD WAV converter - MP3 con verter, MP3 CD WAV, MP3 WAV CD, MP3 to WAV CD, CD WAV to MP3, MP3 encoder, MP3 decoder, CD ripper, a udio grabber, MP3 CD WAV player, CD writer, CD burner |
| cd ripper,mp3 to wav,encoder,decoder,recoder,dvd ripper,dvd copy,copyanydvd,free mp3s,download mp3 f ile,freeware |
| rippers, converter, decoder, encoder, burner, decoder, encoder, ripper, burners, decoders, grabbers, ripper, converters, encoders, recorders |
| (SLD : yeware.net) |
|
| zum Seitenanfang ↑ |
| DARTech, Inc. |
| |
| http://www.dartpro.com |
| Developer of software for audio-file restoration, recording, and Karaoke creation. |
| |
| |
| |
| (SLD : dartpro.com) |
|
| zum Seitenanfang ↑ |
| Easy Mix |
| 100% pure mix |
| http://pagesperso-orange.fr/easymix/info1.htm |
| Ultimate solution for mixing with some real turn table. |
| Le Premier Logiciel 100% pure mix |
| 100, dj, music, dance, techno, mixer, mix, nuit, bouger, megamix, night, club, discotheque, animatio n, desperados, biere, whisky, alcools, cola, agence, tournee, sponsor, disc, disque, disco, live, de ejay, magazine, light, sound, son, sono, set, platine, cd, vinyl, dat, minidisc, data, software, log iciel, hyper, active, new, nouveau, clubbing, night clubbing, emploi, job, vendre, acheter, echanger , materiel, info, france, europe, monde, dancing, discomobil, animateur, agencing, label, production , publiciter, media, midi, wav, aif, mp3, lien, bpm, compteur, a, b, c, d, e, f, g, h, i, k, l, m, n , o, p, q, r, s, t, u, v, w, x, y, z, 0, 1, 2, 3, 4, 5, 6, 7, 8, 9 |
| weight, accueil, 0000ff |
pagesperso-orange.fr - rank der domain 3228 (103 in FR)
|
|
| zum Seitenanfang ↑ |
| Fractal Tune Smithy |
| Tune Smithy - music generator and microtonal composition tool - Software for Windows |
| http://robertinventor.com/software/tunesmithy/music.htm |
| Program for playing fractal tunes and exploring microtonal music. Program download, documentation, s creenshots, and background theory. |
| Overview of Tune Smithy - Lambdoma Music Therapy - Lissajous patterns - Microtonal Explorations - Re tune music keyboard - Microtonal features for composers - Retuning Midi File Player - Microtonal Sca les and Tunings - Metronome for Rhythms and Polyrhythms - Chord Progression Player - Play & Create T unes that play endlessly - Musical e-cards - Mouse & PC keyboard music - Mouse & Joystick Theremin - Audio Pitch Tracer - Sounds Harmonic Analysis - Chord Synthesis - CSound - Waveform Player - Calc ulator - All the following features are available when you download my Fractal Tune Smithy music gen erator and microtonal composition tool - Tune Smithy - Windows Software |
| music,microtonal,tune,chord,tune smithy,pc keyboard,waveform player,midi file,fractal tune,mouse pc, music therapy,fractal tune smithy,mouse pc keyboard,tunes play endlessly,Lambdoma Music Therapy,Liss ajous patterns,Microtonal Explorations,Retune music keyboard,Microtonal features for composers,Retun ing Midi File Player,Microtonal Scales and Tunings,Metronome for Rhythms and Polyrhythms,Chord Progr ession Player,Play & Create Tunes that play endlessly,Musical e-cards,Mouse & PC keyboard music,Mous e & Joystick Theremin,Audio Pitch Tracer,Sounds Harmonic Analysis,Chord Synthesis,CSound,Waveform Pl ayer,Calculator |
| document, window, elements, smithy, border, keyboard, function, bordercolor, player, microsoft, filt er, progid, dximagetransform, gradienttype, microtonal, gradient, startcolorstr, endcolorstr, lambdo ma, rhythms, tunings, capabilities, theremin, tuning, backgroundcolor, ff0000, ffffff, microtonal, m etronome, instrument, lissajous, intricate, composition, snowflakes, chords, patterns, dotted, innov ative, musical, ffaaaa, weight, background, csound, ffff7777, explore, ffbb0000, retuning, compose, retuning, harmonic, synthesis |
robertinventor.com - rank der domain 955178 (408114 in US)
|
|
| zum Seitenanfang ↑ |
| Impulse Modeler |
| Reverb impulse response design tool software - Impulse Modeler - Voxengo |
| http://www.voxengo.com/product/imodeler/ |
| Tool for those who use convolved reverbs in their soundworks. Design room impulse responses ranging from small rooms to large echo halls to small "intimate" cabinets to echoing soundscapes. The result ing WAV can be loaded into any convolution reverberator. |
| |
| |
| impulse, modeler, voxengo, pagetracker, impulse, design, download, plugin, response, plugins, maxima lly, reverbs, convolution, simple, gajshost, designed, allows, document, showed, create, software, r everb, setdomainname, touches, voxengo, limiter, recepts, dashed, recepting, setallowlinker, reflect ed, interest, deconvolver, deconvolution, elephant, everything, 179879, mastering, partial, several, emitters, placing, vertices, interconnecting, various, setallowhash, maximizer, emitting, direction s, trackpageview, specified |
voxengo.com - rank der domain 362814 (143711 in US)
|
|
| zum Seitenanfang ↑ |
| RMCA Pro |
| |
| http://www.xdigits.com/midi/rmca.html |
| Realtime MIDI Chord Arranger an auto accompaniment software. It has all major features of a high qua lity MIDI keyboard and the unique ability to create accompaniment styles from midifiles. |
| |
| |
| |
| (SLD : xdigits.com) |
|
| zum Seitenanfang ↑ |
| Sounds Factory |
| Liberty Surf - On n'a rien mis dans le prix, on a tout mis dans le service |
| http://midi.chez-alice.fr/ |
| MIDI Editor is an universal MIDI sounds editor. MIDI shareware and sounds download. |
| |
| |
| bienvenue, service, liberty |
chez-alice.fr - rank der domain 23780 (763 in FR)
|
|
| zum Seitenanfang ↑ |
| NGWave Audio Editor |
| NGWave Audio/Sound/MP3 Editor: Home |
| http://www.ngwave.com/ |
| Sound editing application, record, process, and save sound or music files. Product specifications, s creen shots, tutorial, FAQs, and downloads. |
| NGWave is a lightening-fast sound editor for Windows |
| digital recorder,digital editor,wave editor,sound editor,audio editor,mp3 editor,free download,music ian software,audio production |
| ngwave, images, document, screenshots, ngwave, features, downloads, editing, offers, features, heigh t, editors, registration, interface, obligation, evaluation, editor, support, record, function, tech nologies, developed, affordable, validate, processing, enlarge, required, privacy, convinced, versio n, editor, favorite, purchase, details, intuitive, integrated, contact, compared, download, virtual, metronome, powerful, development, software, generation, cannot, shrink, download, stability, record ing, record |
| (SLD : ngwave.com) |
|
| zum Seitenanfang ↑ |
| Peak Limiter |
| Peak Limiter: Digital Audio High-Quality Sound Reinforcement |
| http://www.x-ways.net/peaklimiter/ |
| Compresses 16-bit PCM sound files such that the result seems unchanged to the human ear. This permit s rising the main volume of the sound file considerably without causing clipping or distortion. |
| Peak Limiter: Digital Audio High-Quality Sound Reinforcement |
| Peak Limiter, sound, wave, wav, PCM, reinforcement, digital, audio, music, speech, compressor, compr ess, limit, normalize, volume, software, Stefan, Fleischmann |
| reinforcement, orders, prices, limiter, digital, quality |
x-ways.net - rank der domain 582027 (233083 in US)
|
|
| zum Seitenanfang ↑ |
|
