| The JavaScript Toolbox |
| Doc JavaScript - JavaScript Toolbox |
| http://www.webreference.com/js/tools/ |
| Many unique tools that create customized scripts. |
| |
| |
| jomfooter, columns, builder, solsect, padding, margin, document, working, decoration, create, javasc ript, newsletters, demonstration, window, messages, internet, internet, height, solsectpad, browser, javascript, border, experts, location, includes, background, solutions, services, partner, windows, bottom, underline, footers, selected, specify, choice, options, resources, button, explorer, repeat , developer, shiran, earthweb, copyright, quinstreet, rights, rotating, search, weight, technology |
webreference.com - rank der domain 33824 (12851 in US)
|
|
| zum Seitenanfang ↑ |
| Personal iMarvel |
| Personal iMarvel |
| http://www.imarvel.com/basic.htm |
| A series of free and fast wizard tools with optional javascript enhancement. Tools include weather, personal finance, search, clock, jukebox, news, calculator, and radio. |
| iMarvel is a free, quick software add-on that will dramatically improve your Internet experience.
Vi sit the home page at http://www.imarvel.com for more information. |
| start page, home page, create, make, imarvel, organizer, best, wizard, desk, marvelous, hoo-hah, sho pping |
| imarvel, personal, document, writeln, wizard, search, internet, wizards, sports, newsphoto, appear, calendar, business, finance, entertainment, traffic, ubrowser, favorites, jukebox, weather, window, screen, button, browser, shopping, center, consumer, directory, control, addresses, investing, sched ule, technical, contains, compact, motivational, because, address, language, accessible, online, sur fing, companion, hundreds, understand, include, winning, little, directory, circle, create |
imarvel.com - rank der domain 821693 (368975 in US)
|
|
| zum Seitenanfang ↑ |
| JavaScript Builders |
| JavaScript | ricocheting.com |
| http://ricocheting.com/js/ |
| Choose and build your own custom JavaScripts by simply filling out input boxes. |
| |
| |
| javascript, description, following, generator, website, slideshow, comment, options, necessary, comm ents, generator, wizard, generates, slideshow, display, create, ricocheting, website, countdown, pag etracker, visitors, javascript, digital, scripts, creates, sounds, window, window, script, gajshost, document, watermark, background, custom, trackpageview, location, define, clicks, launch, google, p rotocol, gettracker, chosing, created, simple, option, unescape, analytics, options, selected, desig n |
ricocheting.com - rank der domain 182580 (71140 in US)
|
|
| zum Seitenanfang ↑ |
| Computers/Programming/Languages/JavaScript/Tools |
|
|
| Computers/Programming/Languages/JavaScript/Tools |
| zum Seitenanfang ↑ |
| JavaScript Creator |
| JHP10 |
| http://www.wsabstract.com/script/JHP10.html |
| Code generation wizards for alert box, background color, prompts, confirm, status message, backgroun d fade. |
| |
| |
| charat, parseint, dec2hex, document, bgcolor, hexchars, length, function, initarray, bgchange, argum ents, content, 0123456789abcdef, return |
| (SLD : wsabstract.com) |
|
| zum Seitenanfang ↑ |
| Javascript Menu Master |
| Harmony Hollow Software - Page moved |
| http://www.harmonyhollow.net/jmm.shtml |
| Create Javascript pulldown menus for your site with ease using this program from Harmony Hollow Soft ware. No programming required. [Popup window after close] |
| |
| |
| seconds, location, software, harmony, hollow, automatically, redirected |
harmonyhollow.net - rank der domain 396222 (161174 in US)
|
|
| zum Seitenanfang ↑ |
| JavaScript Coder |
| Articles and tutorials on JavaScript, Javascript form validation, HTML forms and more |
| http://www.javascript-coder.com/ |
| A windows application that can generate the code for HTML form, form validations, popup windows, Jav ascript buttons. [Shareware] |
| Read about HTML forms, Javascript form submission, form validation, Javascript popup windows and mor e |
| JavaScript code, HTML form, Javascript button, Javascript popup, Form validation, Java script button , Javascript form validation, popup window |
| javascript, window, method, button, validation, action, dynamically, handling, software, tutorial, p agetracker, windows, simple, submit, design, gajshost, document, button, programmatically, submittin g, script, element, submit, switching, article, without, coding, validation, javascript, simfatic, s ubmitted, articles, 4502881, elements, initdata, popular, advanced, copyright, multiple, getelementb yid, basics, tutorial, beginners, created, quickly, trackpageview, google, 3cscript, unescape, analy tics, javascript |
javascript-coder.com - rank der domain 15280 (5694 in US)
|
|
| zum Seitenanfang ↑ |
| AsenSoft |
| Calendar Creator Software, Create calendars with this software tool |
| http://www.asensoft.com |
| JavaScript authoring tools to generate popup windows and image roll overs without writing JavaScript and file utility to change file properties and split files. |
| Calendar Creator Software, Create calendars with this software tool |
| calendar creator, create calendar, calendar software, calendar creator software |
| calendar, calendars, calendar, software, creator, create, software, special, photos, creator, highly , configurable, custom, personalized, download, support, purchase, contact, templates, remember, cal ender, creation, pictures, allows, create, easily, family, please, customize, friends |
asensoft.com - rank der domain 966629 (413013 in US)
|
|
| zum Seitenanfang ↑ |
| JavaScript Joystick Plug-in |
| javascript-joystick -
Project Hosting on Google Code |
| http://www.bigredswitch.co.uk/toolbox/joystick/ |
| A free browser plug-in to enable JavaScript to access joysticks and gamepads (this ability can be th e passed onto other browser plug-ins). ActiveX for IE and Netscape plug-in versions. [Download at sa mples page] |
| |
| |
| codesite, activity, background, gstatic, repeat, images, project, document, height, javascript, java script, google, menuicon, hosting, joystick, sprite, dropdown, devices, access, joysticks, browser, plugins, featured, getelementsbytagname, installer, nowrap, people, overflow, medium, location, func tion, sitetracker, prettyprint, gamepad, firefox, activex, browserplug, labels, safari, privacy, app lets, powered, downloads, license, examples, folder, examples, cwoffenden, owners, repository, detai ls |
| (SLD : bigredswitch.co.uk) |
|
| zum Seitenanfang ↑ |
| Computers/Programming/Languages/JavaScript/Tools |
|
|
| Computers/Programming/Languages/JavaScript/Tools |
| zum Seitenanfang ↑ |
| PagePopupMaker |
| PagePopupMaker: Popup window generator - javascript. |
| http://www.devicode.com/popup123/ |
| Generate code needed to create popup windows. It can create a wide variety of popups, such as page l oad, page close, link, form button, mouse over or even image link. [Shareware] |
| Devicode PagePopupMaker generate all the script and code needed to create popup windows. Features in clude: Choose size and position or even full screen window; Personalize your Popup selecting propert ies of the window; Choose the event which will activate your Popup code; Preview your Popup at any m oment |
| popup maker, popup generator, javascript popup,internet marketing tool, popup window,
create popup s, make popups, javascript popup generator, pagepopupmaker, page popup maker, pop, popup, pop ups, p opups, pop-ups,
generate, javascript, HTML, code, CSS, js, builder, marketing, traffic, increase, money, freeware,instant, popup making tool,
ad, advert, advertise, open page, link, display, DHTML |
| window, windows, pagepopupmaker, javascript, popups, download, generator, create, generate, visitors , location, increase, section, proper, perfect, activation, support, products, seconds, technology, windows, devicode, copyright, pentium, rights, through, detailed, numerous, examples, process, reven ue, system, interest, traffic, reserved, requirements, generates, generate, unload, intuitive, inter face, improved, delayed, automatically, automatically, closes, instructions, version, purchase, mini mum, displayed |
| (SLD : devicode.com) |
|
| zum Seitenanfang ↑ |
| Javascript Object Editor |
| JOE: Help |
| http://www.informatrix.ch/joe/joehelp.html |
| Online tool to browse and edit the Javascript object hierarchy (or DOM) of your browser. |
| |
| |
| properties, window, objects, object, licence, browser, change, server, access, editing, elements, en able, return, property, software, options, installation, javascript, introduction, download, button, browsers, contains, explore, javascript, select, agreement, hierarchy, belonging, crowded, instead, prefered, internal, showed, allows, capabilities, starting, detail, options, objects, course, publi c, warmly, welcomed, published, nobody, question, guilty, damage, comments, selection |
| (SLD : informatrix.ch) |
|
| zum Seitenanfang ↑ |
| PopUp Generator |
| Internet Marketing Products and Webmaster Tools |
| http://www.marketingrocket.com/prodpopup.php |
| Generates JavaScript codes for all types of Popup windows [Commercial] |
| Affordable and exclusive Internet Marketing Products and Webmaster Tools. |
| internet,marketing,promotion,webmaster,web,design |
| protection, bottom, marketingrocket, ebooks, webmaster, marketing, internet, information, affiliate, affiliate, bandwidth, rocket, images, products, increase, products, welcome, available, tracks, ent itled, thieves, exclusive, anyone, select, please, including, hottest, rocketstops, commission, mega packa, prevents, copying, people, browsers, protection, offers, premier, rocketimage, bundles, toget her, package, priced, affordable, bargain, rockets, incredibly, informationsite, product, discover, publishing, writing |
marketingrocket.com - rank der domain 960679 (28565 in GB)
|
|
| zum Seitenanfang ↑ |
| Kaosweaver DHTML Scripts Extensions |
| Kaosweaver - Dreamweaver Extensions |
| http://www.kaosweaver.com/extensions/index.php?pcat=11 |
| Javascript script generators. [Commercial] |
| Weave fast, dream more with Kaosweaver's Dreamweaver extensions. Money Back Guarentee |
| Dreamweaver Extensions, Dreamweaver Objects, Extensions, Objects, Javascripts, Adobe Dreamweaver, ka osweaver, Dreamweaver, Dreamweaver plugin, Dreamweaver plugins, Dreamweaver addon, Dreamweaver addon s, Dreamweaver addins, Dreamweaver addin |
| random, images, extensions, behavior, gallery, slideshow, dreamweaver, images, extensions, category, search, create, subtracts, divide, scripts, multiplies, commercial, released, premium, number, comm ercial, description, settings, version, extension, server, object, navigation, productivity, miscell aneous, javascript, dynamic, effects, command, ecommerce, shopping, captions, clockdisplay, optional , experience, webpages, sequential, popular, advanced, accountblog, kaosweaver, homeextensionscartyo ur, imagesgetting, dynamic, webpage, breadcrumbshelping |
kaosweaver.com - rank der domain 957957 (397400 in US)
|
|
| zum Seitenanfang ↑ |
| OnMouseOver Generator |
| Website Goodies - OnMouseOver Generator MouseOver |
| http://www.websitegoodies.com/enhance/mouseover.shtml |
| Creates copy-and-paste JavaScript code for mouseover image flips. |
| Generate mouseover image flips with this free code generator. Create single image rollovers or entir e navigation menus with generated javascript |
| mouseover, onmouseover, generator, javascript, rollover, image flip, free tool, code |
| onmouseover, create, reviews, document, border, javascript, pagetracker, generator, passes, protocol , location, 3cscript, website, website, unescape, script, javascript, gajshost, appear, mouseover, m ouseover, center, background, object, adhere, location, submit, multiple, webpage, javascripts, gene rate, developed, maintained, services, w3counter, copyright, grossman, gettracker, initdata, trackpa geview, google, analytics, reddit, stumbleupon, useful, second, itshould, original, others, bookmark , linking |
websitegoodies.com - rank der domain 98950 (37480 in US)
|
|
| zum Seitenanfang ↑ |
| Tito Software Studio |
| Tito Software - Leader in javascript debugger and profiler |
| http://titosoftware.com |
| Includes both JavaScript debugger and profilers. [Commercial] |
| Tito Web Studio currently includes two main functionalities: JavaScript Debug and JavaScript Profile , Web Page Functionality Test will be added in the near future. |
| debug javascript,javascript debugger,JavaScript profiler, JavaScript profile, debugger ,JavaScript,A JAX, tito,tito web studio |
| studio, quality, software, javascript, supports, debugger, market, software, committed, assurance, p rofiling, password, developers, company, download, feature, profiler, snapshots, debugger, performan ce, development, customers, customer, script, stable, capable, efficiently, operations, classic, com plex, lengthy, handling, visually, various, spreadsheet, displayed, performance, lengths, colored, e xecution, unlike, indicate, microsoft, version, account, forgot, register, release, account, detaile d, expression |
| (SLD : titosoftware.com) |
|
| zum Seitenanfang ↑ |
| Simple JavaScript Profiler |
| Simple JavaScript Profiler v. 0.1 |
| http://a-hw.narod.ru/programs/cnt/scripts/profiler/index.html |
| Allows profile object-oriented scripts within HTML/XHTML pages. Works with DOM browsers like IE4+, M ozilla, Netscape 6+, Opera. |
| |
| |
| profiler, javascript, scripts, cookie, execution, navigator, script, simple, simple, really, oxygenw orks, opinion, feedback, replace, kuninmay, interested, requests, screen, javaenabled, colordepth, p ixeldepth, height, appname, document, spylog, please, parsefloat, random, substring, appversion, pro file, object, oriented, allows, within, browsers, features, justify, family, download, decoration, s orting, capabilities, issues, perform, optimizations, developer, mention, mozilla, netscape, average |
narod.ru - rank der domain 313 (12 in RU)
|
|
| zum Seitenanfang ↑ |
| Dynamic Popup Generator |
| Dynamic Popup Generator |
| http://www.dynamic-popup-generator.com/ |
| Offers downloadable software for generating popup windows, popunder windows and DHTML hover windows. |
| Start Enjoying a Massive Surge in Sales, Commissions and Subscribers using Next Generation Popups li ke Unblockable DHTML... |
| popup generator,popup software,unblockable,dhtml,hover,floating |
| popups, generator, popups, visitors, dynamic, product, michael, software, countdown, feature, genera tor, ecourse, features, instant, without, visitor, create, generate, pressure, message, design, webs ite, minutes, conditional, before, content, subscribers, income, thanks, browsers, investment, profi t, button, problem, effects, technology, program, generators, absolutely, version, already, fantasti c, generating, friendly, within, version, problems, excellent, discount, programs, slideup |
dynamic-popup-generator.com - rank der domain 937184 (15354 in CA)
|
|
| zum Seitenanfang ↑ |
| Tigra Menu Online Builder |
| JavaScript Menu Builder |
| http://www.javascriptmenubuilder.com/ |
| Web application allowing to build cross-browser DHTML navigation systems. No JavaScript programming skills are required. Also exist Windows version (requare .Net framework). |
| Javascript DHTML Drop-Down Menu Navigation Builder |
| JavaScript menu, DHTML menu, client side menu, DHTML, Free Menu, site, navigation, html, client side , web, netscape, explorer, IE, opera, DOM, control, cross browser, support, frames, target, download |
| border, collapse, password, calendar, pagetracker, services, builder, online, scroller, design, padd ing, softcomplex, component, control, gallery, builder, results, stages, online, script, application , questions, slider, gajshost, personal, document, products, tables, margin, validator, contact, cus tomer, suggestions, hesitate, product, regarding, offers, background, silver, screens, bottom, copyr ight, regardless, charge, generated, rights, analytics, 3cscript, google, javascript, initdata |
| (SLD : javascriptmenubuilder.com) |
|
| zum Seitenanfang ↑ |
| Aevita |
| Disable the right click on your pages | Protect HTML | No Right Click |
| http://www.aevita.com/web/norightclick/ |
| A tool to disable right click on web page to prevent users from saving images and viewing the source code. [Freeware] |
| |
| no right click, javascript |
| support, source, viewing, disables, needed, protect, download, prevents, browsers, programming, know ledge, javascript, encryption, features, password, extracting, robots, addresses, disable, products, mozilla, navigator, netscape, backup, enabled, wizard, middot, explorer, interface, protection, sup port, uninstall, install, encrypt, advanced, technical, internet, prevent, borrowing, images, others , clicking, strong, comparison, ability, enables, bottom, following, supported, compare, product |
aevita.com - rank der domain 975635 (400433 in US)
|
|
| zum Seitenanfang ↑ |
| MsAgent Javascript Editor |
| MsAgent Javascript Editor - Cool Javascript For Marketing, Increase Sales |
| http://instantagent.netfirms.com |
| Tool help adding MS Agent technology to website pages. |
| Providing cool javascript software tools for website promotion and fun. Visit us to learn how easy i t is to give your website a marketing edge and unique design look to increase sales. |
| cool software, cool edit software, cool java software, cool software streaming, computer cool softwa re, resell right, ebook resell right, master resell right, e book with resell right, resell right so ftware, software master resell right, work at home business opportunity, work at home opportunity, w ork from home opportunity, work from home business opportunity, work at home based business opportun ity, business online opportunity, based business home online opportunity, business home online oppor tunity, business homebased online opportunity, business online opportunity turnkey, business make mo ney online opportunity, increase sales, increase online sales, business home increase sales, increas e sales productivity, increase internet marketing sales, increase the company sales, increase web si te sales, java script editor, java script html editor, java script text editor, download java script editor, java script rich text editor, java script html editor web based |
| visitors, popups, javascript, msagent, anything, editor, service, display, software, important, ordi nary, netfirms, marketing, nature, javascript, routines, create, agents, combine, attention, automat ically, grabbing, floating, character, speech, windows, something, already, microsoft, windows, befo re, message, characters, freely, around, products, direct, promote, computer, easily, animated, gest ure, onscreen, bought, information, product, additional, direct, webpage, instantly, creation |
netfirms.com - rank der domain 3937 (1483 in US)
|
|
| zum Seitenanfang ↑ |
| Jvw Popup maker and DHTML ad generator |
| Javascript popup window maker software. |
| http://www.jvwinc.com/popupmaker.html |
| Creates popup ads using Javascript. [Windows, Commercial] |
| Javascript popup window and popup ads which will bypass all popup blockers. Javascript popup is here to stay. |
| javascript popups, popup window, popup ads, Dhtml ads, floating windows |
| software, window, generator, javascript, create, javascript, support, bottom, visitors, download, su bscribers, create, blocker, increase, average, clicking, knowledge, disappears, seconds, browser, bu tton, floating, viewership, effective, popups, screenshots, jvwinc, killers, reason, features, scrip t, attention, blockers, server, testing, running, upload, generated, contact, advertisements, suppor t, online, testimonials, multiple, offline, important, rotate, popupsads, correctly, explorer, messe nger |
jvwinc.com - rank der domain 818806 (306916 in US)
|
|
| zum Seitenanfang ↑ |
| Simple-Code.Net |
| |
| http://www.simple-code.net |
| Free online webmaster tools to generate Javascript and HTML code including prompts, popup, drop down menu. |
| |
| |
| |
simple-code.net - rank der domain 660543 (274520 in US)
|
|
| zum Seitenanfang ↑ |
| HTML Popup Maker |
| HTML Popup Maker - create unstoppable popups |
| http://www.htmlpopups.com/ |
| Generates JavaScript code for html popup windows. |
| Free html popup window maker. Create unstoppable popup windows |
| html dhtml popup unstoppable pop-up maker |
| window, document, dropin, crossobj, scroll, function, calunits, layers, scrolltop, pageyoffset, true body, return, unstoppable, sidebar, getelementbyid, nuisance, becomming, special, offers, control, s elect, choices, commerce, appear, directions, bouncelimit, divisible, create, popups, addbookmark, a ddfavorite, external, addpanel, direction, visitors, windows, direct, parseint, visibility, initbox, visible, setinterval, dropstart, prevent |
| (SLD : htmlpopups.com) |
|
| zum Seitenanfang ↑ |
| PopUpNow! |
| Javascript popup window maker, make popup windows easily |
| http://popupmaker.asensoft.com |
| A tool to create JavaScript Popup windows for webpages. [Commercial] |
| PopUp making software to make javascript popups |
| popup, popup maker, make popup, javascript popup, popup window maker |
| javascript, popupnow, rollnow, javascript, download, webpages, allows, windows, needed, without, cod ing, single, images, button, window, easily, create, buttons |
asensoft.com - rank der domain 966629 (413013 in US)
|
|
| zum Seitenanfang ↑ |
| Antechinus JavaScript Editor |
| JavaScript Editor: create, edit, syntax check, debug, format, find and organize your JavaScript, CSS, PHP and HTML code |
| http://www.c-point.com/javascript_editor.php |
| A JavaScript code editor. Unified color-coded syntax, context-sensitive help, complete JavaScript re ference, categorized source code solutions. [Shareware] |
| Bring life to your website with JavaScript Editor: instantly add multilevel menu, e-Commerce, form v alidation, multimedia, and much more. |
| JavaScript editor,javascript multilevel menu,javascript editors |
| javascript, editor, function, editing, functions, design, coding, allows, software, internet, errors , document, antechinus, automatically, debugging, editor, create, template, quickly, without, debugg er, templates, complete, exactly, documents, easily, example, applications, development, single, web site, maintain, unique, includes, program, through, another, visual, formatter, organize, better, be autifier, instantly, visually, script, download, testing, working, videos, powerful, visual |
c-point.com - rank der domain 215787 (81187 in US)
|
|
| zum Seitenanfang ↑ |
| ScrypTik |
| Javascript editor with syntax error checking, Java script validator | ScrypTik Javascript Editor |
| http://www.purpleoar.co.nz/scryptik |
| A Javascript authoring tool which has a built-in Javascript parser to find errors while the file is being edited. [Shareware] |
| Frustrated with pesky Javascript errors? Let ScrypTik editor find syntax errors for you. ScrypTik is a Javascript editor with a built-in Javascript parser. A xhtml/Javascript authoring tool and syntax checker (or validator) that checks all javascript code |
| scryptik,javascript,editor,syntax,checker,validator,errors |
| javascript, editor, scryptik, scryptik, import, errors, javascript, modules, script, syntax, validat or, version, programming, system, document, editor, license, browser, developers, button, available, checking, friendly, numbers, future, usages, scryptik, pagetracker, parser, garland, browser, detai ls, jscript, authoring, download, functions, include, because, called, frustration, clicking, licens eus, course, download, loaded, server, purchase, gajshost, experience, previous, immediately |
| (SLD : co.nz) |
|
| zum Seitenanfang ↑ |
| Yaldex |
| Best JavaScript Editor - Ajax Editor |
| http://www.yaldex.com/ |
| Offers multiple programs and scripts. [Windows, Commercial] |
| |
| |
| javascript, editor, tutorial, effects, tutorial, scripts, google, editor, manual, javascript, specia l, reference, properties, easily, controlled, colored, scrollbars, create, events, source, validator , insert, automatically, powerful, window, program, references, validate, statustitle, generates, at tributes, methods, debugger, allows, debugger, features, editing, library, highlight, language, stat us, advanced, scrollbars, writing, professionally, elements, intellisense, context, simplify, intell isense, creates |
yaldex.com - rank der domain 88149 (3479 in IN)
|
|
| zum Seitenanfang ↑ |
| Ribbon Generator |
| Diagonal Advertising Banner Design | Free Corner Web Banner Ads |
| http://www.websiteribbon.com |
| Provides a ribbon generator to copy and paste on a website. |
| Free advertising banner web design tool to make on websites a corner diagonal banner ad containing a message and optional link. |
| diagonal banner, web banner, advertising banner, ad banner, web design, webmaster tool, website ribb on, corner message, banner creator |
| banner, design, banner, diagonal, tahoma, advertising, verdana, diagonal, website, advertising, opti onal, software, corner, aliceblueantiquewhiteaquaaquamarineazurebeigebisqueblackblanchedalmondbluebl uevioletbrownburlywoodcadetbluechartreusechocolatecoralcornflowerbluecornsilkcrimsoncyandarkbluedark cyandarkgoldenroddarkgraydarkgreendarkkhakidarkmagentadarkolivegreendarkorangedarkorchiddarkreddarks almondarkseagreendarkslatebluedarkslategraydarkturquoisedarkvioletdeeppinkdeepskybluedimgraydodgerbl uefeldsparfirebrickfloralwhiteforestgreenfuchsiagainsboroghostwhitegoldgoldenrodgraygreengreenyellow honeydewhotpinkindianredindigoivorykhakilavenderlavenderblushlawngreenlemonchiffonlightbluelightcora llightcyanlightgoldenrodyellowlightgreenlightgreylightpinklightsalmonlightseagreenlightskybluelights latebluelightslategraylightsteelbluelightyellowlimelimegreenlinenmagentamaroonmediumaquamarinemedium bluemediumorchidmediumpurplemediumseagreenmediumslatebluemediumspringgreenmediumturquoisemediumviole tredmidnightbluemintcreammistyrosemoc |
websiteribbon.com - rank der domain 914458 (362088 in US)
|
|
| zum Seitenanfang ↑ |
| Image Map Creator |
| HTML-Image map Creator WYSIWYG - uses AJAX |
| http://www.kolchose.org/simon/ajaximagemapcreator/ |
| Provides an online tool to generate image maps. |
| |
| |
| margin, thinkadproduct, center, background, bottom, padding, creator, netscape, border, display, rel ative, position, website, browsers, action, decoration, regions, f0f0f0, created, repeat, wysiwyg, u seslibs, shooting, ajaxian, pillows, recommended, flattr, create, safari, galeon, konqueror, engine, mozilla, system, windows, libraries, partially, kolchose, cubicle, hidden, overflow, indoor, golfin g, microblimp, people, keyboard, digital, ajaximagemapcreator, underline, bluetooth, virtual |
kolchose.org - rank der domain 958163 (68332 in DE)
|
|
| zum Seitenanfang ↑ |
| Jaxcent |
| Jaxcent |
| http://www.jaxcent.com/ |
| Provides a server-side Java API for JavaScript and AJAX. Integrates with standard servlet containers , and provides access to the client DOM hierarchy from Java. |
| Jaxcent: Java AJAX without JavaScript |
| Java AJAX, AJAX Java, AJAX |
| jaxcent, programming, javascript, available, download, server, framework, provides, applications, in terfaces, session, features, various, single, access, client, samples, existing, documentation, plea se, application, servers, directly, included, rather, earlier, normal, programmatic, environment, mo dels, unlike, integrations, examples, servlet, sample, making, providing, concentrates, itself, eleg ant, questions, feedback, jaxtut, contact, european, deployed, released, integrate, straightforward, required, online |
| (SLD : jaxcent.com) |
|
| zum Seitenanfang ↑ |
| MouseOver Button Wizard |
| MouseOver Button Wizard |
| http://www.mobw.net/ |
| A windows program designed to generate the code needed for mouseover buttons quickly and easily. |
| |
| |
| wizard, button, program, mouseover, buttonsup, buttons, information, copying, pastingnew, linking, w ithout, imagescopy, section, released, codethe, professional, version, buttonsalternate, developers, beginning, whether, rollovers, enabled, designed, freeware, javascript, advanced, separate, allows, button, clickednew, include, create, quickly, easily, features, preview |
| (SLD : mobw.net) |
|
| zum Seitenanfang ↑ |
| Scriptomizers - JavaScript |
| Scriptomizers - Webmaster Tools, HTML, CSS and Javascript Code Generators |
| http://scriptomizers.com/ |
| Online tools for creating customized cut-and-paste JavaScript, including image mouseover effects, al ert messages, and popup windows. |
| Free webmaster tools, Generate useful html, css and javascript code including tables, iframes, promp ts and css styles |
| webmaster tools,free,html,css,javascript,code,generator,coding,table builder,iframes,css generator,s tylesheets,javascript prompts,pulldown, popup |
| scriptomizers, webmaster, generation, services, generator, instantly, scripts, customized, services, criteria, automatic, premier, redirection, scriptomizer, favorites, javascript, homepage, prompt, s criptomizer, problems, suggestions, repairs, computer, friends, repair, questions, computer, complet e, iconosystems, comments, generator, hosting, shortly, another, released, created, another, hosted, languages, support, cincinnati, surrounding, networking, section, titled, remotely, buttons, messag es, prompts, mouseovers, confirmation |
| (SLD : scriptomizers.com) |
|
| zum Seitenanfang ↑ |
| ToJS |
| TheAvatara |
| http://theavatara.homestead.com/ |
| Converts html files to JavaScript 'includes' - helpful when space is limited or code is need in seve ral places. |
| This web site was created for FREE at www.homestead.com. Visit www.homestead.com to get your free w eb site - no programming required. |
| |
| include, javascript, script, javascript, homestead, upload, converter, somewhere, functions, leaves, intact, properly, appear, disabled, browser, supported, created, required, programming, either, cou rse, language, source, webserver, simple, function, giving, document, 9155028, username, theavatara, happens, remember, sounds, change, included, convert, conversion, nesscarry, encodes, orginal, char cters, number, allows, problem, example, message, display, program, reading, preserving |
homestead.com - rank der domain 2511 (975 in US)
|
|
| zum Seitenanfang ↑ |
| JSLint |
| JSLint, The JavaScript Code Quality Tool |
| http://jslint.com/ |
| The JavaScript Verifier takes a JavaScript source and scans it. If it finds a problem, it returns a message describing the problem and an approximate location within the source. It does not prove that your program is correct. |
| |
| |
| tolerate, background, margin, padding, border, disallow, assume, button, functions, errors, function , require, javascript, strict, family, jslint, members, monospace, maximum, strict, quality, indent, decoration, active, adsafe, center, jslint, statement, unfiltered, language, dangling, variables, u ndefined, inefficient, workarounds, handlers, fragments, syntax, identifiers, subscripting, operator s, crockford, douglas, jslint, reserved, rights, indentation, predefined, copyright, number, length |
jslint.com - rank der domain 100335 (38305 in US)
|
|
| zum Seitenanfang ↑ |
|
