| CSIR |
| CSIR - Council for Scientific and Industrial Research |
| http://www.csir.co.za/ |
| South Africa. Sourcing and developing of science and technologies for the African industry. Design, development and laboratory services for the textile, clothing and related industries. Also, technolo gy acquisition and implementation. |
| CSIR - Council for Scientific and Industrial Research |
| csir, africa, alliance, competitive, consulting, decision, development, engineering, excellence, glo bal, global challenges, governance, implementation, innovation, industry, integrity, international e xperience, international alliances, partner, policy, policy formulation, product development, produc t, relevance, research, sadc, service, science, science &, technology, solution, south africa, s trategy, support, technology, technical, quality, assessment, aeronautical, aerospace, biology, buil ding, capital, communication, conference, construction, chemical, crime, defence, educate, environme nt, food, forestry, information, library, magnetic, manufacturing, materials, mining, observatory, p ilot, prototype, prevention, reality, road, satellite, space, sport, textile, tourism, train, transp ort, venture, virtual, vitual reality, water, csir, research, consulting, engineering, south africa |
| fadeimages, images, syntax, science, lastmoddate, africa, fadearray, theimages, document, membranes, conference, highlight, research, tutoring, published, burned, conference, researcher, parameters, c anvasbase, technology, relevant, individual, slideshowid, pupils, tutors, southern, algorithm, onlin e, chatter, secondary, nanofibre, centre, september, chitosan, information, august, available, funct ion, lastmodday, lastmodyear, degree, dynamicdrive, fadeshow, lastmodmonth, length, displayorder, bo rderwidth, research, revised, satellite |
co.za - rank der domain 11146 (29 in ZA)
|
|
| zum Seitenanfang ↑ |
| DTNW. German Center for Textile Research |
| Willkommen an der Universität Duisburg-Essen |
| http://www.uni-duisburg.de/Institute/DTNW/ |
| Germany. Non-profit organization, funded by industry and government, involved in fundamental and app lied research in production processes and performance of textiles. Based in the University of Duisbu rg. |
| |
| |
| universit, duisburg, campus, essener, tagespflegestelle, kleinkinderbetreuung, dienstag, alumni, hau ptnavigation, thickbox, zielgruppennavigation, kontakt, willkommen, breite, nderung, letzte, starter , lehramt, lehramtsstudium, bersicht, master, downloads, studieng, fachgebiete, bewerben, seitenanfa ng, webredaktion, online, bewerben, einschreiben, highlights, informationen, mitnehmen, rderungen, f risten, termine, kosten, durchblick, personen, organisation, infoline, volltext, services, twitter, pendelbus, forschung, webmail, tsbibliothek, fakult, studium, vorlesungsverzeichnis |
uni-duisburg.de - rank der domain 541782 (36339 in DE)
|
|
| zum Seitenanfang ↑ |
| Fraunhofer-Gesellschaft |
| Home – Fraunhofer-Gesellschaft |
| http://www.fraunhofer.de/english/ |
| Germany. Private company for contract research in all fields of the engineering sciences. Industrial research in textile technology development and automated processing techniques. Also, textile testi ng services. English and German. |
| |
| |
| fraunhofer, energy, gesellschaft, research, research, contact, energy, technologies, navigation, ele ctricity, others, stumbleupon, customers, career, publications, motivation, events, institutes, topi cs, establishments, scientists, commercial, services, hauptmen, ilevel, target, basket, future, rese archmore, environment, mobility, benefits, peoplehealth, security, communication, imprint, fraunhofe r, protection, source, online, leading, organizations, required, following, content, network, entire , process, systems, covering, skills |
fraunhofer.de - rank der domain 25920 (1284 in DE)
|
|
| zum Seitenanfang ↑ |
| Business/Textiles_and_Nonwovens/Textiles/Resources/Research |
|
|
| Business/Textiles_and_Nonwovens/Textiles/Resources/Research |
| zum Seitenanfang ↑ |
| INNOVATEXT. Textile Engineering and Testing Institute |
| |
| http://www.innovatext.hu/ |
| Hungary. Research, development and testing institute for the Hungarian textile and apparel industrie s. Links to partner organizations. English and Hungarian. |
| |
| |
| |
| (SLD : innovatext.hu) |
|
| zum Seitenanfang ↑ |
| ITCTI. Information Technology Center for the Textile Industry |
| INFORMATION TECHNOLOGY CENTRE FOR TEXTILE INDUSTRY-ATIRA Ahmedabad-HomePage |
| http://www.itcti.com/ |
| India. Government funded research and information institute for the Indian textile and apparel indus try, focused on the development of electronic databases. |
| This is the site about Textile R & D organization of INDIA located at Ahmedabad. It is also prov iding services like consultancy,training etc. |
| Textile,R&D,ahmedabad,ATIRA,ITCTI,training,consultancy,management |
| scrollmessage, substring, window, length, industries, research, ahmedabad, textile, ministry, impact , information, performance, relatated, textiles, viewed, 800x600, copyright, resolution, direct, cen tres, network, projects, homepage, settimeout, create, welcome, status, technology, centre, function , information, centre, industry, undertake, technology, development, industry, apparel, centre, text ile, excellence, textiles, having |
| (SLD : itcti.com) |
|
| zum Seitenanfang ↑ |
| MCCT. Montreal Centre for Contemporary Textiles |
| |
| http://www.textiles-mtl.com/ |
| Canada. Non-profit corporation, dedicated to research, design, innovation, development and dissemina tion of information related to the crafts of weaving and spinning. Links to educational programs and related web sites. English and French. |
| |
| |
| contemporains, centre, textiles |
| (SLD : textiles-mtl.com) |
|
| zum Seitenanfang ↑ |
| NITRA. Northern India Textile Research Association |
| NITRA's Home Page |
| http://www.nitratextile.org/ |
| Part of a group of four facilities, involved in basic and applied scientific research and developmen t for the textile industry. Also, testing and consultancy services, and organizers of seminars and w orkshops. List of publications. |
| |
| |
| development, consultancy, training, testing, faculty, research, library, updated, product, contact, courses, oriented, selected, textiles, excellence, protective, candidates, various, courses, centre |
| (SLD : nitratextile.org) |
|
| zum Seitenanfang ↑ |
| RICTA. Research and Information Center for Textiles and Apparel Science |
| |
| http://www.ricta.or.kr/english/index.html |
| Korea. Center for the collection and analysis of textile and apparel related information, and the de velopment of a scientific database to support research and improve industrial competitiveness. Engli sh and Korean. |
| |
| |
| |
| (SLD : or.kr) |
|
| zum Seitenanfang ↑ |
| Business/Textiles_and_Nonwovens/Textiles/Resources/Research |
|
|
| Business/Textiles_and_Nonwovens/Textiles/Resources/Research |
| zum Seitenanfang ↑ |
| SASMIRA. Synthetic and Art Silk Mills' Research Association |
| sasmira Textiles |
| http://www.sasmira.org/ |
| India. Cooperative venture of the Indian fiber and textile industry, dedicated to basic and applied research in polymers and intermediates, man-made fiber, yarns and textile fabrics. Also, commercial consulting and testing services. List of publications and journals. |
| |
| |
| research, sasmira, proposal, industry, synthetic, association, foresight, period, mooted, pioneers, number, composed, agencies, government, culminated, earlier, establishment, industrial, research, op erative, organisation, scientific, council, supported, creating, granted, societies, registration, t extiles, sasmira, established, january, cooperative, venture, institute, scientific, technological, functional, independence, textile |
sasmira.org - rank der domain 883178 (325546 in US)
|
|
| zum Seitenanfang ↑ |
| Selen Fiber Materials Technology Co., Ltd |
|
| http://www.china-selen.com/ |
| China. Government science institute involved in research and development activities in textile chemi cals, man-made fiber engineering, and printing and dyeing technologies. English and Chinese. |
| |
| |
| |
| (SLD : china-selen.com) |
|
| zum Seitenanfang ↑ |
| Textiles Intelligence, Ltd |
| Textiles Intelligence: Research, Analysis and Publications for the world's fibre, textile and apparel industries. |
| http://www.textilesintelligence.com/ |
| UK. Textile research and publishing company. Business information on the global fiber, textile and a pparel industries. Searchable database of market reports. Link to glossary of industry terms. |
| |
| |
| textiles, intelligence, apparel, reports, apparel, textile, global, industry, information, industrie s, global, update, subscription, cotton, analysis, performance, during, company, trends, fibres, tex tiles, textile, technical, performance, worldwide, market, staple, quality, contain, address, receiv e, discount, business, online, conference, research, contact, activewear, technical, marketsresearch , internationalisation, sourcing, topics, covering, glossary, papers, nonwovens, period, search, bus iness, events |
textilesintelligence.com - rank der domain 395920 (12878 in GB)
|
|
| zum Seitenanfang ↑ |
| TMTE. Hungarian Society of Textile Technology and Science |
| Forward to start |
| http://www.tmte.hu/ |
| Research and information exchange organization for engineers, technicians, economists and entreprene urs in the textile and garment industries. English, Hungarian and German. |
| |
| |
| scrollbar, ffffff, margin, forward, e3e4ec, decoration, darkshadow, 2629a6, shadow, highlight, 3dlig ht, honlapj, 2728a7, style123, e2e2e2, helvetica, verdana, family, center, bottom, style1, backgroun d, 16165f |
| (SLD : tmte.hu) |
|
| zum Seitenanfang ↑ |
| MANTRA. Man-made Textiles Research Association |
| Untitled Document |
| http://www.mantrasurat.org/ |
| India. Independent organization, focused on research and development, and testing and technical serv ices to the man-made fiber textiles industry. List of publications. Links to related sites. |
| |
| |
| document, untitled |
| (SLD : mantrasurat.org) |
|
| zum Seitenanfang ↑ |
| Canesis Network, Ltd |
| AgResearch |
| http://www.canesis.com/ |
| New Zealand. Independent organization that evolved from the Wool Research Organization of New Zealan d (WRONZ), dedicated to providing textile technology, research and development services, and commerc ial and marketing expertise and capabilities to the textile industry. Articles and papers on PDF fil es. Includes directory of partner companies. |
| |
| |
| rotateit1, cphmaster, agresearch, jssctl00, playctl00, oobject, science, function, tableitemctl00, t ssctl00, document, zealand, fieldays, review, research, research, institute, exhibit, management, pa rasite, richardson, stories, appointed, number, getelementbyid, contains, slideshowspeedctl00, searc h, exitem, cleartimeout, visibility, mystery, national, download, images, release, dungbells, practi ces, industry, drenching, mcmeekan, memorial, towering, column, complete, centrepiece, undefined, co pyright, latest, receives, limited |
| (SLD : canesis.com) |
|
| zum Seitenanfang ↑ |
| AITEX. Technological Textile Institute |
| Instituto Tecnológico Textil -AITEX |
| http://www.aitex.es/ |
| Spain. Private non-profit research, development and training institute for companies and individuals involved in the textile industry, dedicated to the promotion of innovation and technological develo pment. Technical consultancy. Testing, auditing and certification services. English and Spanish. |
| AITEX - el Instituto Tecnológico Textil, se ha
consolidado como centro de referencia de investigaci ón, innovación y servicios técnicos avanzados para los sectores textiles, confección y textiles técn icos. |
| AITEX, aitex, instituto, tecnológico, tecnologico, textil, textiles, investigación, innovación, estu dios, laboratorio textil, ensayos textiles, formación, cursos a medida, proyectos textiles |
| janewsflash, location, deportivas, superficies, laboratorio, textil, federaci, acreditaci, reconocim iento, internacional, congreso, revista, deportivas, document, column, gajshost, instituto, pagetrac ker, gettracker, segunda, script, aitexpueden, trackpageview, oekotexdurante, 1140931, mantenerse, d escargar, sitemap, unescape, materiales, 3cscript, analytics, google, tecnologico, designed, copyrig ht, protocol, joomlart, octubre, celebra, acerca, creada, idiomas, replace, javascript, informados, deportivos, currentitem, totalitem, interval, 97c8730aa693f60439cf3cf4558ce5ea |
| (SLD : aitex.es) |
|
| zum Seitenanfang ↑ |
| CLOTEFI. Textile, Clothing and Fiber Technological Development Company SA |
| |
| http://www.etakei.gr/ |
| Greece. University of Athens institute for textile and garment research and development, active in t echnical, information and consultancy services, training and international cooperation. |
| |
| |
| |
| (SLD : etakei.gr) |
|
| zum Seitenanfang ↑ |
| Centrocot SpA |
| Centro Tessile Cotoniero e Abbigliamento. |
| http://www.centrocot.it/ |
| Italy. Center for testing, research, development and training, created by textile companies, trade o rganisations and government. Also, certification and calibration services. English and Italian. |
| |
| centri tessili it, centro tessile, dpi, dispositivo di protezione individuale, ecolabel, tessile abb igliamento, tracciabilita prodotto tessile, centri taratura sit, centrocot it, ricerca industria tes sile, formazione tessile |
| abbigliamento, tessile, centro, cotoniero |
| (SLD : centrocot.it) |
|
| zum Seitenanfang ↑ |
| ISMAC. Institute for Macromolecular Studies |
| CNR-ISMAC, Istituto per lo Studio delle Macromolecole (Biella) |
| http://www.bi.ismac.cnr.it/ |
| Italy. Research institute, focused on the properties, and chemical and physical characteristics of t extile materials, industrial process technologies, the development of new analytical laboratory meth ods and the working environment. English and Italian. |
| |
| |
| tessili, biella, tecniche, agrave, aziende, ricerca, attivit, istituto, studio, macromolecole, pubbl icazioni, ricerche, amministrazione, website, analitiche, ricerca, prodotti, materiali, servizi, nor mazione, pubblica, processi, capitolati, tecnici, curato, tematiche, proposte, forniture, esercito, militari, civili, specifiche, destinate, consulenze, semilavorati, alessio, finiti, materie, analiti ci, seminari, convegni, varesano, ausiliari, normativa, conformi, rilascio, rapporti, forestale, pol izia, pubblici, strumentazione |
cnr.it - rank der domain 28135 (455 in IT)
|
|
| zum Seitenanfang ↑ |
| Olmetex SpA |
| Olmetex - Tessuti made in Como |
| http://www.olmetex.it/ |
| Italy. Textile research and design company, specialised in silk, cotton, polyester, polyamide and bl ended fabric development. Also, technical finishing for sportswear applications. English and Italian . |
| |
| |
| tessuti, olmetex |
| (SLD : olmetex.it) |
|
| zum Seitenanfang ↑ |
| ÖTI. Austrian Textile Research Institute |
| |
| http://www.oeti.at/ |
| Austria. Independent institute for research and testing in the apparel, flooring and technical texti les industries, fiber and polymer technology, and healthcare and ecology standards and labelling. Al so, consulting and training services. Links to related sites. English and German. |
| |
| |
| |
| (SLD : oeti.at) |
|
| zum Seitenanfang ↑ |
| KDTI. Korea Textile Development Institute |
| |
| http://www.textile.or.kr/ |
| Non-profit, public institute for textile testing, development, research and education. English and K orean. |
| |
| |
| |
| (SLD : or.kr) |
|
| zum Seitenanfang ↑ |
| BTRA. Bombay Textile Research Association |
| BTRA - Bombay Textile Research Association |
| http://www.btraindia.com/ |
| India. Institute for applied research, testing and development, created by the Indian textile and no nwovens, man-made fibers, textile machinery, dyestuffs and chemicals manufacturing industries. |
| |
| |
| download, shockwave, quality, pluginspage, version, number, shockwaveflash, runcontent, codebase, ma cromedia, association, research, bombay, textile, height, version, swflash |
| (SLD : btraindia.com) |
|
| zum Seitenanfang ↑ |
| CTA. China Textile Academy |
|
| http://www.cta.com.cn/ |
| Government institution dedicated to chemicals, textile, nonwovens and fiber related research, develo pment, testing and standardization. English and Chinese. |
| |
| |
| |
| (SLD : com.cn) |
|
| zum Seitenanfang ↑ |
| CTR. Centre for Textile Research |
| CTR – University of Copenhagen |
| http://ctr.hum.ku.dk/ |
| Denmark. University of Copenhagen center of excellence, dedicated to textile related research and de velopment activities. Calendar of events. Links to related sites. |
| |
| University of Copenhagen, Centre for Textile Research |
| research, textile, copenhagen, navigation, university, textile, centre, workshop, contact, informati on, global, oversigt, research, sidebar, kolofon, footer, ekstra, search, production, workshop, ackn owledgements, archive, seminars, conferences, publications, library, invite, annette, borrell, njals gade, borrell, highlights, highlights, archaeology, experimental, denmark, production, students, res earchers, dressid, departments, faculties, employment, education, bookpunkt, wrapper, shortcuts, hos tname, indhold, content, document |
ku.dk - rank der domain 31528 (62 in DK)
|
|
| zum Seitenanfang ↑ |
| LEITAT. Textile Technology Center |
| leitat.com |
| http://www.leitat.com/ |
| Spain. Center for research, development and technological services in the textile and related indust ries. Technical testing, certification and consulting for fibers, yarns, fabrics and textile product s. English, Catalan and Spanish. |
| |
| |
| support, frames, browser, leitat |
| (SLD : leitat.com) |
|
| zum Seitenanfang ↑ |
| IAT. Institute of Textile Architecture |
| IAT |
| http://www.iat.com.pl/ |
| Poland. Government institute for research and development in process technologies, applications, qua lity standards and marketing of materials and products for the textile industry. Also, testing and t echnical consultancy services. Calendar of conferences. Links to related sites. English and Polish. |
| |
| |
| sportowe, wordpress, toksport, comments, uncategorized, posted, archives, pagesabout, categories, de velopment, blogroll, narciarskie, search, welcome, delete, wywiady, blogging, support, hotels, techn iki, zamocowan, turystyka, odpoczywam, festival, entries, powered, proudly, budowa, stadionu, przegl ad, themes, planet, plugins, suggest, register, armatura, zakopane, polecamy, documentation, weblog, another, border, pierwsze, polsce, antenowego, prezentuj, background, content, repeat, kubrickbg, i mages |
| (SLD : com.pl) |
|
| zum Seitenanfang ↑ |
| IIMW. Institute of Textile Materials Engineering |
| IIMW |
| http://iimw.ewitryna.pl |
| Poland. Textile research and development center, specialised in manufacturing technology and testing of technical and furnishing fabrics, and jacquard pattern design. Also, production of woven fabrics for upholstery and furnishing. English and polish. |
| |
| |
| instytut, zapraszamy, kiennictwa, przekszta, ynierii, materia, kienniczych |
ewitryna.pl - rank der domain 947192 (11192 in PL)
|
|
| zum Seitenanfang ↑ |
| Australian TCF Technology Network |
| Australian TCF Technology Network |
| http://www.tcftechnet.com.au/ |
| Network for public and private companies, research institutions, individuals and finance providers a ctive in the Australian textiles, apparel and footwear industries, providing a company database, and organizing workshops and seminars. Calendar of events. Links to related sites. |
| Australian TCF Technology Network |
| Australian TCF Technology Network home page textiles clothing footwear industry database register re gistration |
| australian, network, network, victorian, managed, companies, technology, government, information, vi cstart, council, commercialisation, images, development, environment, technology, future, initiative , global, innovation, banner, macromedia, sectors, events, aspect, version, linkages, contents, rese archers, between, browser, copyright, australia, privacy, creating, disclaimer, representative, prog ram, minimum, ensure, aspects, facilitation, meetings, registrants, charges, opportunity, possible, additional, receive, discount, textile |
| (SLD : tcftechnet.com.au) |
|
| zum Seitenanfang ↑ |
| 3T Textil Technologie Transfer GmbH |
| 3T Textil Technologie Transfer GmbH, Aachen |
| http://www.3t-gmbh.de/ |
| Germany. Commercial institute for research, development and technology transfer in textile machinery and manufacturing technologies. Multi-lingual site. |
| |
| |
| aachen, transfer, technologie, textil |
| (SLD : 3t-gmbh.de) |
|
| zum Seitenanfang ↑ |
| CTF. Textile Innovation Center |
|
| http://www.ct.upc.es/ctf |
| Spain. Research and development institute in the Polytechnic University of Catalonia, dedicated to r esearch, innovation, technology transfer and technical services to the textile manufacturing industr y. Links to information and education resources. Calendar of events. English, Catalan and Spanish. |
| |
| |
| |
upc.es - rank der domain 136058 (2122 in ES)
|
|
| zum Seitenanfang ↑ |
| Mikawa Textile Research Institute |
|
| http://www13.ocn.ne.jp/~amtrij/english/index.html |
| Japan. Government and industry sponsored institute, involved in research and development on textile manufacturing, processing and finishing technologies. Also, technical consultancy. English and Japan ese. |
| |
| |
| |
| (SLD : ne.jp) |
|
| zum Seitenanfang ↑ |
| Sulzer Innotec AG |
| Sulzer Innotec - Forschung, Entwicklung, Technologie, Innovation, Beratung |
| http://www.sulzerinnotec.com/ |
| Switzerland. Research and development unit of the Sulzer group. Includes descriptions of capabilitie s in materials and surfaces, fluid technology, testing and metrology, and engineering and production techniques and technologies. English and German. |
| |
| Forschung, Entwicklung, Technologie, Innovation, Ventures, Inkubator, Projektmanagement, Beratung |
| sulzer, innotec, engineering, entwicklung, mungstechnik, diagnostik, technische, materialpr, dosearc hhighlite, ftsbedingungen, akustik, maschinendynamik, veranstaltungen, konzern, sulzerinnotec, manag ementsystem, script, werkstoffe, kompetenzen, gefragt, gasturbinen, technologien, einstieg, damals, gesundheit, geschaffen, worden, nachhaltige, relevanten, integriertes, prozessorientiertes, elemente , geschichte, sechzigj, beinhaltet, sicherheit, umwelt, qualit, tradition, ilevel, desktopdefault, p agename, window, onload, 54sb3g, javascript1, document, highlitesearch, function, zentralen, stellen |
| (SLD : sulzerinnotec.com) |
|
| zum Seitenanfang ↑ |
| Transatlantic Textile Network |
| Transatlantic Textile Network |
| http://www.ita.rwth-aachen.de/ttn/ttn.html |
| Joint consortium of six universities involved in textile technology in Europe and the United States, funded by the European Commission and the US Department of Education. |
| |
| |
| frames, browser, unterst, werden, network, verwendet, transatlantic, textile |
rwth-aachen.de - rank der domain 19368 (989 in DE)
|
|
| zum Seitenanfang ↑ |
| SITRA. South India Textile Research Association |
| Welcome to The South India Textile Research Association |
| http://www.sitra.org.in/ |
| India. Joint venture between government and business, dedicated to applied research on textile proce sses, consulting, materials testing and training. |
| name=Keywords>
|
| |
| textiles, services, coimbatore, research, textile, premises, twenty, functioning, governed, administ ration, council, consisting, registered, organisation, research, registration, societies, southern, commenced, foundation, december, jawaharlal, pandit, minister, institutions, reputed, representative s, industry, include, members, central, scientists, governments, scientific, country, service, centr e, powerloom, surveys, publications, medical, contacts, programmes, association, training, consultan cy, testing, development, aerodrome, laboratories, welcome |
| (SLD : org.in) |
|
| zum Seitenanfang ↑ |
| TAM. Textile Research Center |
| |
| http://www.tubitaktam.ege.edu.tr/ |
| Turkey. Research and education institute, and technical consultancy of the Turkish textile industry in cooperation with the Ege University. English and Turkish. |
| |
| |
| |
| (SLD : edu.tr) |
|
| zum Seitenanfang ↑ |
| HapTex. HAPtic sensing of virtual TEXtiles |
| HapTex |
| http://haptex.miralab.unige.ch/ |
| European Union funded research project based at the University of Geneva, on multimodal perception o f textiles in virtual environments, aiming to develop a virtual reality system (including both softw are and hardware) for visuo-haptic interaction with virtual textiles. Library of technical papers on PDF files. |
| |
| |
| haptex |
unige.ch - rank der domain 26621 (846 in FR)
|
|
| zum Seitenanfang ↑ |
| Australian Wool Services, Ltd |
| AWI - Woolmark |
| http://www.woolmark.com/ |
| Research and development institute of the Australian wool textile industry, involved in the commerci alisation of wool technologies and innovations, technical consulting, business information and comme rcial testing of wool fabrics. Owners of the Woolmark, Woolmark Blend and Wool Blend quality tradema rks. Information about fiber processing technologies and wool marketing. Calendar of events. Links t o related sites. |
| |
| |
| rdereporting, woolmark, merino, january, february, november, december, september, august, october, a ustralian, gallery, language, browserdata, navigator, appversion, browser, useragent, galleria, mark et, innovation, border, quality, design, perform, length, licensees, benefits, global, performance, container, innovations, function, natural, document, fashion, encodeuricomponent, pagetracker, texti les, woolgrowers, program, licensing, finishingknittingweavingmaking, contentfontsize, textile, perf ormance, enabled, retailer, shareholder, testing, cookie |
| (SLD : woolmark.com) |
|
| zum Seitenanfang ↑ |
| The Institute of Textile Science |
| The Institute of Textile Science - Home |
| http://www.textilescience.ca/ |
| Canada. Science and technology institute of the Canadian textile industry, involved in research, dev elopment and educational activities, standardisation, knowledge transfer and technical publications. |
| |
| |
| textile, institute, canadian, science, member, technical, federation, professionalisms, canada, orga nizations, related, interest, several, embraces, innovations, promoting, document, function, swapimg restore, incorporated, scientific, textile |
| (SLD : textilescience.ca) |
|
| zum Seitenanfang ↑ |
| ATIRA. Ahmedabad Textile Industry's Research Association |
| ATIRA |
| http://www.atira-rnd-tex.org/ |
| India. Government funded non-profit institute for scientific and applied research and development ac tivities in the Indian textile and allied industries. Links to related sites. |
| |
| |
| |
| (SLD : atira-rnd-tex.org) |
|
| zum Seitenanfang ↑ |
| CTT Group |
| Groupe CTT :: Centre multiservices pour l'industrie textile |
| http://www.groupecttgroup.com |
| Canada. Private, non-profit corporation devoted to improving productivity in the textile, geosynthet ic and para-textile industries. Applied research and testing services for textile materials and prod ucts. English and French. |
| |
| |
| cookie, language, return, document, navigator, indexof, length, userlanguage, groupecttgroup, functi on, getlanguage, getcookie, themes, industrie, import, textile, multiservices, unescape, substring, groupe, centre, location, behavior, general, csshover, client, accueil |
| (SLD : groupecttgroup.com) |
|
| zum Seitenanfang ↑ |
| Centrum Textil |
| |
| http://centrum.tul.cz/ |
| Czech Republic. Textile research and development center, focused on education, and information and t echnology transfer. Based in the Technical University of Liberec. English and Czech. |
| |
| |
| |
tul.cz - rank der domain 163904 (825 in CZ)
|
|
| zum Seitenanfang ↑ |
| Smartex Project |
| smartex | De Montfort University - Leicester, UK |
| http://www.dmu.ac.uk/faculties/art_and_design/research/team/smartex/index.jsp |
| UK. Government backed project within the clothing, footwear and textile related companies in Leicest ershire, combining technical textiles research and development resources with business support requi red to implement specific innovations in order to increase competitiveness of local companies in vie w of lifting of quantitative import restrictions. |
| De Montfort University (DMU) is an academic institution situated in Leicester, UK. The DMU website c ontains information about DMU, listings of undergraduate and postgraduate courses, business and comm unity services and details of our research. |
| De Montfort University, DMU, University, further education, higher education, degree, courses, under graduate, postgraduate, research, professional, campus, Leicester City, Charles Frears |
| technical, textiles, business, smartex, leicestershire, development, addthis, textile, leicester, bu sinesses, research, resources, support, required, provide, employment, within, enterprises, content, access, directly, category, products, sector, university, montfort, innovation, markets, import, th rough, davies, market, approach, medical, programme, research, respond, knowledge, driven, innovatio ns, providing, cluster, skills, enquiries, gateway, resulting, partnership, economic, specific, hbev ent, critical |
| (SLD : ac.uk) |
|
| zum Seitenanfang ↑ |
| TEAM. Textile Engineering and Materials Research Group |
| Textile Engineering and Materials (TEAM) Research Group | De Montfort University - Leicester, UK |
| http://www.dmu.ac.uk/faculties/art_and_design/research/team/ |
| UK. Research group within the Department of Textile Design and Production of the De Montford Univers ity, focused on modelling textile structures, enzyme applications, natural fibers and technical text iles. |
| De Montfort University (DMU) is an academic institution situated in Leicester, UK. The DMU website c ontains information about DMU, listings of undergraduate and postgraduate courses, business and comm unity services and details of our research. |
| De Montfort University, DMU, University, further education, higher education, degree, courses, under graduate, postgraduate, research, professional, campus, Leicester City, Charles Frears |
| research, addthis, design, textiles, category, textile, materials, engineering, import, projects, re search, content, variables, nettles, textiles, including, nettle, hbevent, university, textile, mont fort, default, enquiries, contact, fabrics, partnerships, disclaimer, matthew, further, nettle, catw alksfeatured, developing, videosclothing, details, 2577582, mhorne, website, 116257, 8575head, telep hone, general, logantod, settings, validation, minimum, action, optional, elements, 4489397, urchint racker, tracking |
| (SLD : ac.uk) |
|
| zum Seitenanfang ↑ |
| Inexmoda |
| Inexmoda - Instituto para la exportación de la moda. |
| http://www.inexmoda.org.co/ |
| Colombia. Private, not-for-profit foundation, dedicated to research, publication, education and trai ning, and the sponsoring of trade events in the Colombian textile and apparel manufacturing industry . English and Spanish. |
| |
| |
| radpanel1, dnnradpanelbar, inexmoda, informaci, navigateafterclick, espacio, colombia, inexmoda, col ombiamoda, gajshost, eacute, iacute, asistir, strese, pagetracker, document, colombiamoda, obtener, confecci, textil, sector, escarapela, material, medell, window, nuestros, contrase, manual, servicio s, usuario, incluyendo, orientarse, atenci, algunos, actualizado, mercados, previa, acerca, descarga rlo, enfocadas, normas, comercial, mercado, reglamentaci, mercados, acceso, valores, ricamisi, dispo nible, productos, isciferias |
| (SLD : org.co) |
|
| zum Seitenanfang ↑ |
| My World |
| My World |
| http://www.myworld-textiles.eu/ |
| European wide cooperative research project of national textile organizations, ained at developing a roadmap for mass customisation and personalisation for integrated products and services in the carpe t, upholstery and technical textile markets. Links to partner sites. English and German. |
| |
| |
| centexbel, national, following, centexbel, associations, textil, textilindustrie, fachverband, forsc hungskuratorium, contact, access, project, please, findings, results |
| (SLD : myworld-textiles.eu) |
|
| zum Seitenanfang ↑ |
| TITV Greiz |
| TITV Greiz e.V.: Institut für Spezialtextilien und flexible Materialien |
| http://www.titv-greiz.de/ |
| Germany. Institute for research, development, service, consulting, testing and professional training in the textile industry. English and German. |
| Das TITV Greiz ist als wirtschaftsnahe Forschungseinrichtung Partner für Aufgaben der Forschung, Ent wicklung, Dienstleistung, Beratung, Prüfung und Weiterbildung entlang der gesamten textilen Wertschö pfungskette. |
| Textilforschung,Forschung,smart textiles,akkreditiertes Prüflabor,Textilprüfung,Pr üfung,Medizintextilien,Biofunktionstextilien,Transdermale therapeutische Systeme,Intelligen te Textilien,Smart Clothes,Wearable Computing,Leitfähige Textilien,textile Transpondersyste me,sensorische Textilien,Automobilinnenraumverkleidung,Galvanisch modifizierte Fadenstrukturen,Texti le Schalter,textile Tastatur,textile Schaltungsträger,Schmaltextilien,Bandgewebe,3-D-Wirken ,Abstandsgewirke,Weberei,Textilveredlung,Gradierung,CAD,Schnittbildkonstruktion,Stickerei,Spitzen,Ef fektfadenherstellung,Seminare,Schulung,Weiterbildung |
| forschung, dienstleistung, flexible, materialien, institut, spezialtextilien, weiterbildung, partner , aufgaben, beratung, entwicklung, pfungskette, veranstaltungen, seminare, wertsch, gesamten, textil en, entlang, center, technika, kontaktagbimpressumsuchesitemap, fstelle, wirtschaftsnahe, forschungs einrichtung, willkommen |
| (SLD : titv-greiz.de) |
|
| zum Seitenanfang ↑ |
| Irspin. Slovene Spinning Industry Development Center |
| .:: IRSPIN ::. |
| http://www.irspin.si/ |
| Slovenia. Cooperative project of industry and academia, dedicated to the development and promotion o f education, research and development activities in materials, processes and products in the Slovene textile industry. Lists of projects and member organizations. English and Slovenian. |
| |
| |
| finestra, function, controlla, height, funzione, stringa, viewfoto, document, predstavitev, centra, novice, english, slikazapri, settimeout, prevfoto, irspin, intervallo, window |
| (SLD : irspin.si) |
|
| zum Seitenanfang ↑ |
| Textranet |
| Welcome to Textranet |
| http://www.textranet.net/ |
| France. Non-profit association of European textile research organizations, dedicated to knowledge tr ansfer, facilitate the establishment of trans-national projects, develop and maintain co-operative l inks with professional and textile associations, and provide a forum for the promotion of technical progress within the European textile industry. Links to member and partner sites. |
| Textranet - European Network of Textile Research Organizations |
| Textranet Textile Research |
| european, textranet, technology, conference, platform, international, annual, written, research, tex tranet, administrator, monday, textile, meeting, consumer, research, assembly, mulhouse, congress, g eneral, textile, innovation, regional, national, conference, textiles, sports, europe, institute, or ganized, brussels, applications, innovative, developing, innovations, sports, industry, clothing, fo rgot, public, textiles, details, strategies, feature, current, leaders, organization, chairmen, incl uding, taking, france |
| (SLD : textranet.net) |
|
| zum Seitenanfang ↑ |
| Center for Material & Fibre Innovation |
| Centre for Material and Fibre Innovation |
| http://www.deakin.edu.au/scitech/cmfi/research/areas/fibres.php |
| Australia. Research and development center of the Deakin University, involved in natural and manufac tured fibers, functional textiles, and fiber to fabric processing and quality testing. |
| Centre for Material and Fibre Innovation |
| material and fibre research, textiles, fibres, metals, biomaterials, nanotechnology, polymers, |
| textiles, fibres, fibres, modelling, deakin, research, fabric, processing, isdeakin, centre, materia l, innovation, nanofibres, research, textiles, projects, functional, deakin, powders, applications, docurl, facilities, animal, natural, particularly, numerical, urchintracker, spinning, colour, metal s, modelling, advanced, template, photochromic, university, surface, techniques, conductive, number, electrospun, ugetcookie, fabric, treatment, application, facilities, banner, developed, technique, coloure, fastness, response |
deakin.edu.au - rank der domain 44539 (260 in AU)
|
|
| zum Seitenanfang ↑ |
| 3T Textil Technologie Transfer GmbH |
| 3T Textil Technologie Transfer GmbH, Aachen |
| http://www.3t-gmbh.com/ |
| Germany. Spin-off from the Aachen Institute of Textile Technology, involved in research, development and technology transfer related to the production of textiles and textile machinery. English and Ge rman. |
| |
| |
| aachen, transfer, technologie, textil |
| (SLD : 3t-gmbh.com) |
|
| zum Seitenanfang ↑ |
| IFTH. French Textile and Apparel Institute |
| |
| http://www.ifth.org/ |
| Research and development institute of the French textile and apparel industry, focused on education, training, certification and knowledge transfer. Technical publications. Links to related sites. |
| |
| |
| |
ifth.org - rank der domain 991095 (31669 in FR)
|
|
| zum Seitenanfang ↑ |
| CTEC. China Textile Engineering Society |
| CTIC |
| http://www.ctic.org.cn/en/ctes.asp |
| Membership organization for students, scientists and professionals involved in research and developm ent of textile science and technologies. |
| |
| |
| textile, department, addparam, engineering, textile, weblogo, society, publishing, association, rese arch, science, secretariat, members, technology, project, corporate, quality, images, swfobject, tra nsparent, chinese, medium, present, cities, recruited, branches, technology, science, administrative , individual, consists, academic, committee, liaison, popularization, technique, organization, circl e, enterprises, institutes, renowned, almost, universities, colleges, departments, member, communiti es, social, covering, colour, fashion |
| (SLD : org.cn) |
|
| zum Seitenanfang ↑ |
| Texmedeco. Textile and Health Scientific Network |
| |
| http://www.fibtex.lodz.pl/62_22_101.pdf |
| Poland. Cooperative initiative of research and development centers in the fields of textiles, medici ne and occupational medicine. List of member organizations. Calendar of events. English and Polish. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
|
