| Wool Works FAQ on Yarns |
| Wool Works: frequently asked questions about fibers |
| http://www.woolworks.org/fibers.html |
| List of frequently asked consumer questions about knitting yarns. Information about animal, plant an d man-made fibers, yarn constructions and manufacturing processes.Author: Wendy Chatley Green. |
| |
| |
| fibers, fabric, natural, knitting, cotton, worked, usually, twisted, filaments, sweater, strength, s hrink, smooth, although, strong, together, stronger, because, people, inelastic, pattern, fragile, s tretch, length, washed, acrylics, fabric, ribbon, itself, strand, texture, easily, roving, fluffy, d urable, through, treated, number, spinning, comfortable, knitted, moisture, available, determines, w rapped, needles, expensive, synthetic, polyester, synthetics, polyester |
woolworks.org - rank der domain 983210 (17288 in CA)
|
|
| zum Seitenanfang ↑ |
| The Making of Fiber Glass Yarns |
| |
| http://www.ppg.com/fgs_main/esm.htm |
| Description of the manufacturing process of textile yarns from continuous glass fibers. Detailed pro duction flow chart, clickable for additional information. From PPG Industries. |
| |
| |
| |
ppg.com - rank der domain 84720 (32798 in US)
|
|
| zum Seitenanfang ↑ |
| Textile Link Articles |
| Articles |
| http://www.textilelinks.com/author/index.html |
| Collection of articles on yarn spinning, knitting, fiber and yarn terms and definitions, and wool br eeds and grades. Author: Rosemary Brock. |
| |
| textile, TextileLinks |
| articles, information, spinning, textilelink, provided, worsted, woolen, otherwise, please, textilel ink, artist, copyright, except, personal, shared, freely, copyrighted, server, distribution, source, profit, maintained, pursuits, breeds, contained, posted, notices, copyright, directly, leaders, dou ble, bobbin, rosemary, amount, felted, memories, childhood, spindles, effort, available, written, co llection, textile, community, article, please, thankful, thinking, things, definitions, teaching |
| (SLD : textilelinks.com) |
|
| zum Seitenanfang ↑ |
| Business/Textiles_and_Nonwovens/Industrial_Yarns_and_Sewing_Threads/Resources/Articles_and_Studies |
|
|
| Business/Textiles_and_Nonwovens/Industrial_Yarns_and_Sewing_Threads/Resources/Articles_and_Studies |
| zum Seitenanfang ↑ |
| Steps in Processing Wool into Yarn |
| Steps in Processing Wool |
| http://www.blackberry-ridge.com/prosdscr.htm |
| Short descriptions of fleece skirting, and wool washing, picking, carding, roving, spinning and fini shing processes. From the Blackberry Ridge Woolen Mill web site. |
| |
| |
| fibers, called, fleece, removed, through, grease, spinning, process, roving, before, sometimes, some times, processing, manure, carding, matter, natural, washed, spools, placed, collected, pencil, bobb ins, washing, wooden, knitting, vegetable, together, carding, combing, series, spinning, woolen, rov ings, produce, alignment, machine, forshaug, random, driven, coming, contrast, worsted, thread, pass ed, covered, strips, divides, roving, transfering, knitters |
| (SLD : blackberry-ridge.com) |
|
| zum Seitenanfang ↑ |
| Conductive Yarn |
| |
| http://www.canesis.com/Documents/Yarn_Conductive_yarns.pdf |
| Technical paper describing methods for combining various types of conductive fibers with wool carpet pile, and techniques to create conductive carpet backing. From the Wool Research Organization of Ne w Zealand. |
| |
| |
| |
| (SLD : canesis.com) |
|
| zum Seitenanfang ↑ |
| Spinning Technology Guide |
| Site Map Page 1 - Generated by www.xml-sitemaps.com |
| http://textiletechnology.bravehost.com/ |
| An explanation of the yarn spinning process, from fiber opening and blending to the final yarn testi ng procedures. Author: R. Velmurugan. |
| |
| |
| redvase, padding, background, margin, verdana, border, cotton, sbarinside, normal, spinning, decorat ion, publisher, process, version, content, bravenet, center, bottom, family, helvetica, parameters, strong, leaderboard, creative, bravehost, mysite, documents, visited, technology, comber, underline, textile, weight, tahoma, preconditions, roving, constants, autoleveller, generated, conditioning, w inding, comforspin, testing, parameter, results, operating, factorsrawmaterial, importance, spinner, always, fibres |
bravehost.com - rank der domain 12633 (4727 in US)
|
|
| zum Seitenanfang ↑ |
| Carpet Yarn Finishing and Chemical Treatments |
| |
| http://www.canesis.com/Documents/Yarn_Scouring.pdf |
| Introduction to carpet yarn spinning methods and the wool yarn scouring process. From Wools of New Z ealand. |
| |
| |
| |
| (SLD : canesis.com) |
|
| zum Seitenanfang ↑ |
| Woolen and Worsted Explained |
| |
| http://kws.atlantia.sca.org/Woolen_vs_Worsted_Explained.pdf |
| Brief explanation of the woolen and worsted yarn spinning technologies. Author: Lady Siobhan nocDhui nnshleibhe. |
| |
| |
| |
sca.org - rank der domain 315051 (127195 in US)
|
|
| zum Seitenanfang ↑ |
| Business/Textiles_and_Nonwovens/Industrial_Yarns_and_Sewing_Threads/Resources/Articles_and_Studies |
|
|
| Business/Textiles_and_Nonwovens/Industrial_Yarns_and_Sewing_Threads/Resources/Articles_and_Studies |
| zum Seitenanfang ↑ |
| A Micromechanical Model for Blended Yarns with Fragmented Low-Elongation Fibers |
| |
| http://www.tx.ncsu.edu/jtatm/volume2issue1/articles/godfrey/godfreycomplete.pdf |
| Technical paper presenting a micro-mechanical model for the interaction between fragmented low elong ation-to-break fibers (LE) and high elongation-to-break fibers (HE) in blended yarns, for the evalua tion of the load-extension behaviour of such yarns. Authors: T.A. Godfrey and J.N. Rossettos. |
| |
| |
| |
ncsu.edu - rank der domain 6750 (2483 in US)
|
|
| zum Seitenanfang ↑ |
| Analysis and Enhancement of Carding and Spinning |
| |
| http://www.ntcresearch.org/pdf-rpts/AnRp02/F01-GT06-A2.pdf |
| Extensive paper describing a research project at the National Textile Center, aiming to enhance the fundamental understanding of carding and spinning, and develop new tools to shorten the sequence for staple yarn processing. Project leader: Y. Wang. |
| |
| |
| |
| (SLD : ntcresearch.org) |
|
| zum Seitenanfang ↑ |
| Blended Yarns with a Content of Biological Active Fibers |
| |
| http://www.fibtex.lodz.pl/45_08_19.pdf |
| Technical paper about research into the development of a technology aimed at manufacturing yarns fro m antimicrobial and antifungal fibers for apparel fabrics. Authors: Tadeusz Jackowski and others. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| Buckling of Fibers and Yarns within Ropes and other Fiber Assemblies |
| |
| http://www.tensiontech.com/papers/papers/buckling_fibres_yarns/buckling_fibres_yarns.pdf |
| Extensive technical paper about the effect of buckling of fibers in yarns and ropes under tension, r esulting in failure by axial compression fatigue after repeated cycling. Authors: R.E. Hobbs and oth ers. |
| |
| |
| |
| (SLD : tensiontech.com) |
|
| zum Seitenanfang ↑ |
| What's That Stuff? |
| WHAT'S THAT STUFF? - SPANDEX |
| http://pubs.acs.org/cen/whatstuff/stuff/7707scitek4.html |
| Short article on the history, development and chemical structure of spandex, published in Chemical a nd Engineering News. Author: Marc Reisch. |
| |
| |
| spandex, dupont, stretch, kirkwood, garments, germany, chemical, rubber, started, fabrics, heslep, f oundation, fashion, thread, research, decade, natural, industry, million, sports, presence, shorts, covered, market, future, business, segments, technology, include, documents, police, geneva, produce rs, spandex, polyurethane, amateur, hosiery, champion, enlarged, february, dancewear, tights, comman ding, athletes, online, performance, madonna, singer, innerwear, outerwear, translated |
acs.org - rank der domain 10829 (4151 in US)
|
|
| zum Seitenanfang ↑ |
| Properties of Close Packing of Filaments in Yarn |
| |
| http://www.fibtex.lodz.pl/40_08_16.pdf |
| Study analysing a hypothetical model of the close cross-sectional structure of yarn, and some peculi arities of close packing of yarn. Authors: Donatas Petrulis and Salvinija Petrolyte. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| Size Lubrication Methods for Air-Jet Spun and Ring-Spun Warp Yarns |
| |
| http://www.cotton.org/journal/2000-04/2/upload/jcs04-112.pdf |
| Comparative study addressing the effect of size concentration and lubrication on yarn characteristic s and weaving performance of conventional ring spun and air-jet spun polyester and cotton blended ya rns. Authors: Howard L. Thomas Jr. and James M. Zeiba. |
| |
| |
| |
cotton.org - rank der domain 794776 (317380 in US)
|
|
| zum Seitenanfang ↑ |
| Useful Criteria for Comparing Strength of Yarns |
| |
| http://www.webtex.com.br/arquivosPDF/comparing_strength.pdf |
| Short comparative study of the effects of various amounts of twists introduced to yarns in the spinn ing process. Author: Dr. H.R. Sheikh. |
| |
| |
| |
com.br - rank der domain 931606 (14646 in )
|
|
| zum Seitenanfang ↑ |
| Yarn Strength Dependence on Test Length |
| |
| http://www.fibtex.lodz.pl/38_08_32.pdf |
| Technical paper about the evaluation of yarn strength changes, and the auto-correlation functions of the strength of short yarn links in standard yarn breakage tests. Author: Pavol Lizak. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| A Study of the Nucleation Effect of Pigment Dyes on the Microstructure of Mass Dyed Bulked Continuous Filament Polypropylene |
| |
| http://journal.ippi.ac.ir/manuscripts/ipjE05140307.pdf |
| Technical paper reporting the results of a study on the nucleation effect, tenacity and thermal shri nkage which six pigment dyes have on the microstructure of mass dyed polypropylene BCF yarns. Author s: Hossein Tavanai and others. |
| |
| |
| |
| (SLD : ac.ir) |
|
| zum Seitenanfang ↑ |
| Quantitative Grading of Spun Yarns for Appearance |
| |
| http://www.jstage.jst.go.jp/article/jte/52/1/13/_pdf |
| Technical paper reporting an objective and quantitative method for grading spun yarn appearance deri ved from optical yarn diameter measurements. Authors: Young K. Kim and others. |
| |
| |
| |
| (SLD : go.jp) |
|
| zum Seitenanfang ↑ |
| Stores Consumption in Spinning Mills |
| |
| http://www.sitra.org.in/image/2007-02-07@01-22-13_Focus_Stores.pdf |
| Study on the periodical replacement and consumption rate of consumable stores in Indian yarn spinnin g mills, focusing on top roller cots, aprons, travellers and spindle tapes, and gears, bearings, bel ts and lubricants. Published in Sitra Focus. |
| |
| |
| |
| (SLD : org.in) |
|
| zum Seitenanfang ↑ |
| How to Assess Your Mill's Productivity? |
|
| http://www.sitra.org.in/image/2007-01-19@03-58-37_Howtoass.pdf |
| Technical paper, presenting a detailed study by the South India Textile Research Association on meas ures and methods allowing the assessment of the productivity of yarn spinning mills. Authors: R. Raj amanickam and others. |
| |
| |
| |
| (SLD : org.in) |
|
| zum Seitenanfang ↑ |
| Mechanical Properties and a Physical-Chemical Analysis of Acetate Yarns |
| |
| http://internet.ktu.lt/lt/mokslas/zurnalai/medz/pdf/medz0-76/16%20Pocienes%2075-79.pdf |
| Technical paper about an investigation of the properties of yarns from cellulose acetate fibers deri ved from cotton linters or wood pulp cellulose, and manufactured by different commercial yarn spinne rs. Authors: R. Pociene and others. |
| |
| |
| |
ktu.lt - rank der domain 93105 (93 in LT)
|
|
| zum Seitenanfang ↑ |
| Processing Wool. Part I |
| |
| http://bms.seregon.com/repository/wool/scm/uploads/processingpart1.pdf |
| First part of a fact sheet on wool processing, dealing with shearing, grading, washing, scouring, bl ending, dyeing and carding of wool fibers. |
| |
| |
| |
seregon.com - rank der domain 925847 (379082 in US)
|
|
| zum Seitenanfang ↑ |
| Processing Wool. Part II |
| |
| http://bms.seregon.com/repository/wool/scm/uploads/processingpart2.pdf |
| Second part of a factsheet on wool processing, dealing with spinning, weaving and knitting, fulling and finishing, and the various chemical finishes in use with the industry. |
| |
| |
| |
seregon.com - rank der domain 925847 (379082 in US)
|
|
| zum Seitenanfang ↑ |
| The Turkish Textile Industry |
| |
| http://www.itkib.org.tr/english/about/sectors/textile/textile_info.pdf |
| Extensive article about the history, present state and future development of the Turkish yarn making industry. From the Istanbul Textile and Clothing Association. |
| |
| |
| |
| (SLD : org.tr) |
|
| zum Seitenanfang ↑ |
| Comparison of Different Theoretical Models of Fancy Yarns |
| |
| http://internet.ktu.lt/lt/mokslas/zurnalai/medz/pdf/medz0-76/19%20Petrulytes%2089-92.pdf |
| Technical paper presenting an experimental comparison of fancy yarns of various structures, using tw o different theoretical models for predicting the coil length of the binder yarns. Authors: S. Perul yté and D. Petrulis. |
| |
| |
| |
ktu.lt - rank der domain 93105 (93 in LT)
|
|
| zum Seitenanfang ↑ |
| The Effect of Knitting and Wearing Conditions on the Tensile Characteristics of Blended Yarns |
| |
| http://internet.ktu.lt/lt/mokslas/zurnalai/medz/pdf/medz0-76/17%20Tvarijonaviciene%2080-84.pdf |
| Technical paper analysing the effects of the knitting process, washing procedures and tumbling on th e tensile characteristics of blended yarns constructed from wool, cotton and acrylic. Authors: B. Tv arijonaviciené and others. |
| |
| |
| |
ktu.lt - rank der domain 93105 (93 in LT)
|
|
| zum Seitenanfang ↑ |
| Neps, Seed-Coat Fragments, and Non-Seed Impurities in Processed Cotton |
| |
| http://www.cotton.org/journal/2001-05/1/upload/jcs05-053.pdf |
| Technical paper presenting the results of a study on the effect of mechanical processing procedures on the presence of defects in cotton by examining samples of four different ginning and lint cleanin g combinations, collected after carding and combing. Authors: Karin R. Jacobson and others. |
| |
| |
| |
cotton.org - rank der domain 794776 (317380 in US)
|
|
| zum Seitenanfang ↑ |
| Developments in Spinning |
| |
| http://landofcotton.com/fc/files/spinsys.pdf |
| Short 2003 overview of yarn formation technologies, including descriptions of the ring, open-end or rotor, vortex and jet spinning techniques. Author: William Oxenham. |
| |
| |
| |
landofcotton.com - rank der domain 977773 (418231 in US)
|
|
| zum Seitenanfang ↑ |
| Periodic and Chaotic Motion in Sirofil Yarn Spinning |
| |
| http://www.fibtex.lodz.pl/67_09_27.pdf |
| Technical paper about the establishment of a dynamic model for two-strand yarn processing through ap proximating the oscillating frequencies of sirofil spinning in horizontal and vertical directions, e nabling the analysis of the stability and chaotic characters of sirofil spinning and resulting in a suggestion of optimal spinning conditions for this system. Authors: Li-Na Zhang and Ji-Huan He. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| Worsted Spinning |
| AWI - Design & Market |
| http://www.merinoinnovation.com.au/wps/wcm/resources/file/eb1c730d6fec5ec/worsted_spinning.pdf |
| Description of the technology and dificulties of the worsted spinning process and a review of the la test developments. From Australian Wool Innovation, Ltd. |
| |
| |
| rdereporting, merino, january, australian, february, november, december, woolmark, september, octobe r, august, market, browserdata, language, design, useragent, appversion, browser, innovation, naviga tor, gslider, collections, natural, innovations, retailer, perform, addimage, images, performance, l ength, benefits, intimates, encodeuricomponent, merinocool, comfort, finishingknittingweavingmaking, performance, support, natural, lightweight, industry, cookie, nothing, enabled, methods, innovation , testing, woolgrowers, tempimage, quality, contentfontsize |
| (SLD : merinoinnovation.com.au) |
|
| zum Seitenanfang ↑ |
| Effect of Spindle Diameter and Spindle Working period on the Properties of 100% Viscose MVS Yarns |
| |
| http://www.fibtex.lodz.pl/68_07_17.pdf |
| Technical paper presenting the results of a study on the effects of various spindle diameters and wo rking periods on the properties of viscose MVS yarns, evaluated on the basis of unevenness, hairines s, elongation at break, tenacity and work-of-break (B-work) values. Authors: Huseyin Gazi Ortlek and others. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| Quality of Yarns Spun Using Ring, Compact and Rotor Spinning Machines as a Function of Selected Spinning Process Parameters |
| |
| http://www.fibtex.lodz.pl/60_08_24.pdf |
| Technical paper presenting an analysis of the quality parameters of carded and combed medium staple cotton yarns of various linear densities manufactured using the ring, compact and rotor spinning tec hnologies. Authors: Lidia Jackowska-Strumillo and others. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| The Structure and Properties of Vortex and Compact Spun Yarns |
| |
| http://www.lib.ncsu.edu/theses/available/etd-03172003-132411/unrestricted/etd.pdf |
| Doctor of Philosophy dissertation about the identification of the structural differences which can b e used to explain the properties of air vortex spun and compact ring spun yarns. Author: Guldemet Ba sal. |
| |
| |
| |
ncsu.edu - rank der domain 6750 (2483 in US)
|
|
| zum Seitenanfang ↑ |
| Abrasion Characteristics of Ring Spun and Open-end Spun Yarns |
| |
| http://www.lib.ncsu.edu/theses/available/etd-20011115-182006/unrestricted/etd.pdf |
| Master of Science thesis describing an experimental investigation into the difference in abrasive be haviour of cotton yarn spun with the ring and open-end spinning technologies using a continuous tens ion transport (CTT) tester. Author: Jeremy Jones. |
| |
| |
| |
ncsu.edu - rank der domain 6750 (2483 in US)
|
|
| zum Seitenanfang ↑ |
| Comparing the Structure of Rabbit Hair-Cotton Blended Rotor and Ring Spun Yarns |
| |
| http://www.rjta.org/download.php?paper=1&paper_id=04_1_04 |
| Technical paper presenting a comparative study of the differences in fiber distribution in various r atios of rabbit hair and cotton blended yarns spun with rotor and ring spinning technologies. Author s: Lijun Qu and others. |
| |
| |
| address, server, information, please, database, password, mailadmin, idiblxof, hostname, control, us ername, update, address, webmail, pachosting, services, website, change, accounts, please, domain, o utlook, creating, express, uploading, webpage, secondary, account, before, primary, yourname, upload , follows, webmail, nvcds832, folder, localhost, password, permission, remove, server, outgoing, acc ount, httpdocs, incoming |
| (SLD : rjta.org) |
|
| zum Seitenanfang ↑ |
| Translation of Structure and Strength Properties of Different Spun Yarns on Fabric Strength |
| |
| http://www.ft.tul.cz/science/konference/indoczech-conference/conference_proceedings/abstract/India_01.pdf |
| Technical paper presenting a study of the influence of the structure and physical properties of yarn s spun with different spinning technologies, on the tensile strength of fabrics woven with said yarn s. Authors: S.M. Ishtiaque and others. |
| |
| |
| |
tul.cz - rank der domain 159370 (799 in CZ)
|
|
| zum Seitenanfang ↑ |
| The Colorimetric Measurement of Melánge Woollen Yarns: A New Optical Tool |
| |
| http://medwelljournals.com/fulltext/jeas/2007/877-881.pdf |
| Technical paper introducing a novel method for accurate colorimetric measurement of melánge woollen yarns using an optical system of flat scanner acquisition combined with colorimetric techniques. Fro m the Journal of Engineering ans Applied Sciences. Authors: Rocco Furferi and Monica Carfagni. |
| |
| |
| |
medwelljournals.com - rank der domain 408358 (164334 in US)
|
|
| zum Seitenanfang ↑ |
| Textile Articles |
| |
| http://textilearticles.co.cc/ |
| Collection of research studies, articles, projects and trend analysis related to natural and man-mad e fibers, yarn spinning technologies, and textile manufacturing, processing and finishing. |
| |
| |
| |
co.cc - rank der domain 41018 (20 in CC)
|
|
| zum Seitenanfang ↑ |
| Development of Characterization Methodologies of Fiber Surface Characteristics: Surface/Process Analysis |
| |
| http://www.p2pays.org/ref/08/07066.pdf |
| Technical paper presenting a study of the friction behaviour of as-spun yarns as part of a larger re search effort aimed at developing methodologies which can be utilised for fiber surface characteriza tion. Authors: Yehia E. El Mogahzy and others. |
| |
| |
| |
p2pays.org - rank der domain 863001 (338283 in US)
|
|
| zum Seitenanfang ↑ |
| Applicability of Flax and Hemp as Raw Materials for Production of Cotton-like Fibers and Blended Yarns in Poland |
| |
| http://www.fibtex.lodz.pl/47_06_13.pdf |
| Review of basic research and new concepts in the processing of flax and hemp fiber focused on the pr oduction of cotton and wool like fibers and yarns. Authors: Waldemar Cierpucha and others. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| Control of Yarn Inventory for a Cotton Spinning Plant. Part I |
| |
| http://www.tx.ncsu.edu/jtatm/volume2issue2/articles/thoney/thoney1_full.pdf |
| Part I of a series of papers about yarn inventory control, presenting a process control based method ology attempting to control the inventory at a specified level using separate proportional control e quations for each yarn type. Authors: Russel E. King and others. |
| |
| |
| |
ncsu.edu - rank der domain 6750 (2483 in US)
|
|
| zum Seitenanfang ↑ |
| Control of Yarn Inventory for a Cotton Spinning Plant. Part II |
| |
| http://www.tx.ncsu.edu/jtatm/volume2issue2/articles/thoney/thoney2_full.pdf |
| Part II of a series of papers about yarn inventory control, comparing the performance process contro l based methodology and the traditional min/max system in situations in which the demand from period to period exhibits correlation. Authors: Russel E. King and others. |
| |
| |
| |
ncsu.edu - rank der domain 6750 (2483 in US)
|
|
| zum Seitenanfang ↑ |
| The Influence of Spun Yarns on Needle Life |
| |
| http://www.groz-beckert.de/website/media/en/media_master_699_low.pdf |
| Technical brochure about the influence of yarn finishes and fiber contamination during yarn spinning , on the wear of knitting needles. From Groz-Beckert KG. |
| |
| |
| |
| (SLD : groz-beckert.de) |
|
| zum Seitenanfang ↑ |
| Comparative Study of Quality Parameters of Knitted Fabric from Air-jet and Ring Spun Yarn |
| Fulltext |
| http://scialert.net/pdfs/jas/2005/277-280.pdf |
| Technical paper presenting research into the mechanical properties of knitted fabrics made from air- jet and ring spun yarns in various blend ratios of cotton and polyester. Authors: Babar Shahbaz and others. |
| |
| |
| fulltext |
scialert.net - rank der domain 126038 (4455 in IN)
|
|
| zum Seitenanfang ↑ |
| Studies on Cottonized Jute Composite Structures Spun on Ring, Rotor and Air-Jet Spinning Systems |
| |
| http://www.saskflax.com/documents/fb_papers/58_Nawaz.pdf |
| Technical paper presenting a study investigating the spinning performance for rotating ratios of jut e and its blends with cotton, viscose and polyester to improve the tensile behaviour of composite st ructures of cottonized jute blended yarns spun on ring, rotor and air-jet spinning systems. Authors: Sheikh Muhammad Nawaz and others. |
| |
| |
| |
| (SLD : saskflax.com) |
|
| zum Seitenanfang ↑ |
| Study about the Interactions Between Melange Yarn Properties and Fiber Damage |
| |
| http://dspace.lib.fcu.edu.tw/bitstream/2377/3955/1/ce05atc902007000078.pdf |
| Technical paper presenting a study about cotton fiber damage and its effect on the properties of rin g and open-end rotor spun greige and dyed melange yarns. Authors: A.A. Gharehaghaji and others. |
| |
| |
| |
| (SLD : edu.tw) |
|
| zum Seitenanfang ↑ |
| The Application of Untoxic Polymers at Sizing and Bleaching Textile Processes |
| |
| http://facta.junis.ni.ac.rs/walep/walep99/walep99-10.pdf |
| Technical paper about the use of untoxic and water soluble polymers in cotton yarn sizing and bleach ing operations. Authors: Dragan M. Djordjevic and others. |
| |
| |
| |
| (SLD : ac.rs) |
|
| zum Seitenanfang ↑ |
| Coal Acids - A Potential Warp Size for Continuous Filament Yarns |
| |
| http://www.anl.gov/PCS/acsfuel/preprint%20archive/Files/03_3_ATLANTIC%20CITY_09-59_0101.pdf |
| Working paper summarizing the results of an evaluation of a mixture of water soluble aromatic polyca rboxylic acids produced by caustic oxygen oxydation of coal for its potential as warp sizing agent f or continuous filament yarns. Authors: Keith B. Bozer and others. |
| |
| |
| |
anl.gov - rank der domain 34134 (12762 in US)
|
|
| zum Seitenanfang ↑ |
| Effect of Yarn Parameters on the Knittablity of Glass Ply Yarn. |
| |
| http://www.fibtex.lodz.pl/70_15_90.pdf |
| Technical paper investigating the knittablity of glass ply yarns of different parameters by testing their mechanical performance using a self-developed knit simulating apparatus. Authors: Xiao-ming Li ua and others. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| Impact of Sizing on Physico-Mechanical Properties of Yarn |
| |
| http://www.fibtex.lodz.pl/48_10_32.pdf |
| Technical paper examining breaking force, elongation at break and abrasion resistance before and aft er the sizing of yarns spun in five different spinning mills. Authors: Stana Kovacevic and Zeljko Pe nava. |
| |
| |
| |
lodz.pl - rank der domain 12072 (191 in PL)
|
|
| zum Seitenanfang ↑ |
| Size Effect of Interlacer |
| pdf test |
| http://www.journalarchive.jst.go.jp/jnlpdf.php?cdjournal=jte1955&cdvol=45&noissue=3&startpage=71&lang=en&from=jnlabstract |
| Technical paper reporting on experiments conducted in order to exmine the size effect of an interlac er, using several interlacers with different diameters of yarn duct and air-jet nozzle. Authors: Yos hiyuki Iemoto and others. |
| |
| |
| testlocation, english |
| (SLD : go.jp) |
|
| zum Seitenanfang ↑ |
| Yarn Preparation |
| |
| http://www.techno-preneur.net/information-desk/sciencetech-magazine/2006/sep06/Yarn_preparation.pdf |
| Feature article about the various processes spun and filament yarns are subjected to prior to weavin g and knitting into textile fabrics. |
| |
| |
| |
techno-preneur.net - rank der domain 617545 (11687 in IN)
|
|
| zum Seitenanfang ↑ |
| A Comparative Study on the Quality Control of Jute Yarn Conventional Drawing Method vs Modern Drawing Method |
| |
| http://docsdrive.com/pdfs/ansinet/ajps/2002/646-647.pdf |
| Technical paper presenting the results of a comparative study of the effectiveness of quality contro l in mono-head high-speed and the traditional push-bar type drawing systems. Authors: A.K.M. Mahabub uzzaman and others. |
| |
| |
| |
docsdrive.com - rank der domain 728544 (297233 in US)
|
|
| zum Seitenanfang ↑ |