| Cape Wools SA |
| Welcome to Cape Wools |
| http://www.capewools.co.za/ |
| South Africa. Non-profit company, established and owned by farmers and industry, and involved in woo l textile research and development, technology transfer, promotion, and collection and processing of market information and statistics. |
| Independant and objective information and statistics on the South African Wool Industry |
| wool, sheep, farming, agriclture, south africa, wool buyers, brokers, bkb, cmw, wool producers |
| available, knitwear, merino, woolworths, stores, duration, micron, offering, category, micronby, pri ces, styles, garment, charcoal, retails, ranges, pullover, micron, function, window, transitions, tr ansition, addevent, retailer, indicators, lambswool, highest, garments, developed, country, wcollect ion, easeout, around, selected, showing, auction, sleeve, orange, august, domready, yellow, slipover , african, height, industry, industryour, receive, winter, specific, sale317, average |
co.za - rank der domain 11218 (28 in ZA)
|
|
| zum Seitenanfang ↑ |
| Cashmere and Camel Hair Manufacturers Institute |
| Cashmere and Camel Hair Manufacturers Institute |
| http://www.cashmere.org/ |
| USA. International institute for research, education and promotion of cashmere and camel hair produc ts. Garment care and labelling guides. Links to organizations and test facilities. |
| |
| |
| cashmere, general, definition, testing, products, cashmere, animal, retailer, institute, manufacture rs, superfine, education, through, information, cooperation, contact, integrity, industry, reserved, consumers, rights, objective, maintain, beacon, retailers, spilhaus, president, telephone, street, consumer, boston, garment, mislabelling, recycled, retailers, resourcesfor, consumers, council, memb ers, councilgeneral, contact, factsfor, production, checklist, established, promote, interests, prot ect, genuine, topics, woolmembers |
| (SLD : cashmere.org) |
|
| zum Seitenanfang ↑ |
| Cotton Research and Development Corporation |
| Cotton Research & Development Corporation: Home |
| http://www.crdc.com.au/ |
| Australia. Partnership between Government and the Australian cotton industry, involved in research, innovation, and knowledge creation and transfer. Technical and market information on PDF files. Link s to related sites. |
| Home page of CRDC,The official site of Cotton Research and Development Corporation |
| cotton research, cotton research and development corporation, crdc, cotton and wool, cotton industry , australian cotton, cotton, cotton research, cotton australia, cotton industry, mike logan, bruce f inney, bruce pyke, cotton rdc, cotton farming,,cotton research and development corporation, crdc, co tton, australian cotton industry, acgra |
| background, cotton, radius, navbutton, 444f7b, conference, 6e7649, footerbar, ffffff, sitebgtable, c orporation, border, development, maincontentccsettings, autopad, australian, b3b3b1, research, navbu ttonccsettings, navbuttonccobj, curvycorners, maincontentdiv, applycornerstoall, maincontentccobj, a ntialias, validtags, foundation, 818181, australia, sponsor, publications, climate, spotlight, libra ry, business, bodycontentarea, pagesmallheader, pageheader, 1000px, height, headerbar, 444444, texta rea, getelementbyid, document, select, function, bottom, may2010boll, navbar, window |
| (SLD : crdc.com.au) |
|
| zum Seitenanfang ↑ |
| Business/Textiles_and_Nonwovens/Fibers/Natural/Resources/Research |
|
|
| Business/Textiles_and_Nonwovens/Fibers/Natural/Resources/Research |
| zum Seitenanfang ↑ |
| DWI. German Wool Research Institute |
| DWI an der RWTH Aachen e.V. |
| http://www.dwi.rwth-aachen.de/ |
| Department of the University of Technology in Aachen, Germany. Fundamental and applied research on w ool and its uses in the textile industry. Cooperative industrial projects. Seminars and conferences. English and German. |
| |
| |
| browser, navigation, seiten, unseren, benutzen, aachen, frames, unterst |
rwth-aachen.de - rank der domain 19871 (969 in DE)
|
|
| zum Seitenanfang ↑ |
| IENICA. Interactive European Network for Industrial Crops and their Applications |
| |
| http://www.ienica.net/ |
| Project funded by DG Research of the European Commission, linking independent organisations and init iatives which are involved in the development of renewable materials from crops throughout Europe. |
| |
| |
| european, please, netscape, report, around, navigate, ienica1, updated, constantly, please, refresh, reload, designed, upgrade, javascript, incompatible, technical, problems, explorer, internet, scena rio, french, finnish, lithuanian, german, swedish, summary, hungarian, commission, industrial, netwo rk, interactive, applications, research, funded, national, inforrm, industrialcrops, biomatnet, poli cy, research, overview, sheets, specification, reports, updates, status, accessing, associated, mark et, booklet |
| (SLD : ienica.net) |
|
| zum Seitenanfang ↑ |
| IJT. Institute of Jute Technology |
| Welcome to IJT |
| http://www.ijtindia.org/ |
| India. Industrial research organization founded by the University of Calcutta and the Indian Jute Mi lls' Association, focused on technology development and transfer, education and training. Also, test ing, inspection, and technical consulting services. List of journals, and training courses. |
| |
| |
| admission, notification, librarian, activities, library, copyright, matters, details, faculty, cours e, invited, courses, faculty, mmloadmenus, welcome, members, library, applications, contact, council , laboratories, governing |
| (SLD : ijtindia.org) |
|
| zum Seitenanfang ↑ |
| Nova Institute for Ecology and Innovation GmbH |
| nova-Institut GmbH |
| http://www.nova-institut.de/ |
| Germany. Private and independent institute for research in sustainable resources, and technical and market research and consulting services in industrial fiber. Links to informational sites. English a nd German. |
| |
| |
| import, institut, ressourcenmanagement, konomie, bereichnachwachsende, rohstoffe, biowerkstoffe, kom munikation, strukturfonds, regionalentwicklung, regionalentwicklung, bereichnachhaltige, impressum, kontakt, margin, helvetica, family, divids, background, ffffff, 000000, impressum |
| (SLD : nova-institut.de) |
|
| zum Seitenanfang ↑ |
| Supima Association |
| Supima: World's Finest Cottons |
| http://www.supima.com/ |
| USA. Promotion and research organization of US growers of Pima cotton. Extensive history of the deve lopments of Pima and extra long staple (ELS) cotton. Lists of merchants, co-ops and ginners. Calenda r of events. FAQ. Links to Pima and ELS licensing programs. |
| Supima – World’s Finest Cottons – is the luxury fiber of choice used to make the softest and most co mfortable apparel and home fashions. |
| cotton, cotton organization, cotton promotion, Supima cotton, fine cotton, luxury |
| supima, design, competition, episode, launches, guidelines, document, cotton, supply, global, collec tion, information, production, scrollable, quotes, social, gajshost, contact, brooks, brothers, page tracker, function, finest, cottons, campaign, couture, heritages, release, forces, frankfurt, challe nge, copyright, javascript, google, analytics, script, trackpageview, 6219085, gettracker, 3cscript, unescape, edition, prefab, bloomingdale, designers, emerging, episodes, announcing, protocol, handl ers, location |
| (SLD : supima.com) |
|
| zum Seitenanfang ↑ |
| Business/Textiles_and_Nonwovens/Fibers/Natural/Resources/Research |
|
|
| Business/Textiles_and_Nonwovens/Fibers/Natural/Resources/Research |
| zum Seitenanfang ↑ |
| The Woolmark Company |
| AWI - Grow |
| http://www.wool.com.au/ |
| Global organisation owned by Australian woolgrowers. Wool information, research, and education. |
| |
| |
| rdereporting, february, january, november, december, management, october, august, september, austral ia, browserdata, language, instructions, operators, navigator, useragent, browser, appversion, immun ity, queensland, australian, timerite, western, victoria, resistance, drench, pasture, woolgrowers, spectrum, encodeuricomponent, length, breeding, breeding, animals, options, integrated, control, par asite, information, testing, flystrike, prevention, introduction, managing, workshops, pastoral, inn ovation, flystrike, research, tasmania, making |
| (SLD : wool.com.au) |
|
| zum Seitenanfang ↑ |
| European Fine Fibre Network |
| European Fine Fibre Network |
| http://www.macaulay.ac.uk/europeanfibre/ |
| Project of the European Commission, gathering researchers, producer organizations and textile manufa cturers, and engaged in research and development on the production and processing of high quality an imal textile fibers of European origin. |
| European Fine Fibre Network |
| FAIR, fibre, sheep, goat, rabbit, OFDA, wool |
| european, textile, network, project, project, production, development, animals, newsletters, proceed ings, introduction, producing, organiser, information, further, current, activities, seminars, conta ct, please, reports, administrator, modified, ordinator, branco, castelo, partners, biella, continue s, quality, processing, research, animal, fibres, origin, engaged, manufacturers, commission, themat ic, network, organisations, producer, researchers, website, speciality, during, produced, publicatio ns, systems, finished, workshops |
| (SLD : ac.uk) |
|
| zum Seitenanfang ↑ |
| Cotton Quality Research Unit |
| Cotton Quality Research : Home |
| http://www.ars.usda.gov/main/site_main.htm?modecode=66-55-00-00 |
| USA. Research facility at the Clemson University, focused on crop improvement, cotton fiber, process ing and yarn quality, the development of cotton testing instruments, and cotton related safety and h ealth issues. |
| |
| |
| function, return, webtrends, onsitedoms, length, document, quality, cotton, prototype, regexp, windo w, research, version, cookie, statement, indexof, modifiable, downloadtypes, cmatch, tolowercase, co okies, dlatest, enabled, namelen, redirect, dcsext, images, gettime, unescape, settime, idlatest, cm atchcount, substring, typeof, dcssplit, hostname, location, dcsgetcrumb, acookie, dcsgetcookie, dcsg etid, wtloptout, trackevents, seasons, modified, policies, information, nondiscrimination, policy, a ccessibility, privacy |
usda.gov - rank der domain 3496 (1337 in US)
|
|
| zum Seitenanfang ↑ |
| Central Coir Research Institute |
| New Page 1 |
| http://www.ccriindia.org/ |
| India. Official institute for applied research into the extraction and processing of coir fiber, and the development of coir fiber products and processing machinery. Also, extension services, and trai ning activities. |
| |
| |
| cssmenu, display, background, border, images, height, firefox, padding, position, double, decoration , inline, safari, ffffff, repeat, internet, explorer, published, important, dataobj, aaaaaa, margin, papers, verdana, normal, library, absolute, research, supported, browsers, download, select, templa te, customize, windows, navigator, netscape, chrome, mozilla, konqueror, 4792e6, 665500, chemistry, relative, center, collapse, microbiology, extension, engineering, horizontal, vertical |
| (SLD : ccriindia.org) |
|
| zum Seitenanfang ↑ |
| INF. Institute of Natural Fibers |
| |
| http://www.inf.poznan.pl/ |
| Poland. Interdisciplinary research center, involved in applied research in the cultivation and proce ssing of fiber crops, genetic engineering, biotechnology, retting and yarn spinning technology, and machine design for harvesting and processing of textile raw materials. List of Publications. Links t o related sites. English and Polish. |
| |
| |
| instytut |
poznan.pl - rank der domain 6346 (64 in PL)
|
|
| zum Seitenanfang ↑ |
| Central Institute of Coir Technology |
| CENTRAL INSTITUTE OF COIR TECHNOLOGY, BANGALORE |
| http://www.ccriindia.org/Portal/cict/index.htm |
| India. Government institute, established to undertake research in the utilization of brown coir fibe r, and involved in machinery and product development, testing, training and technical assistance, an d the formulation of standards. List of technical articles on PDF files. |
| |
| |
| development, products, research, standards, projects, technical, extension, existing, institute, pro duct, entrepreneurs, equipping, machinery, utilization, improve, testing, facility, institute, insti tute, bangalore, institutes, indian, developed, assistance, activities, service, service, industrial , library, collaborating, digital, formulating, amendment, specialized, objectives, training, vision , extending, making, dissemination, effective, activity, improving, utilize, equipment, entitled, ca pabilities, essential, extension, fibres, blending |
| (SLD : ccriindia.org) |
|
| zum Seitenanfang ↑ |
| The Cotton Corporation of India, Ltd |
| The Cotton Corporation of India Ltd. |
| http://www.cotcorp.gov.in/ |
| India. Governmental marketing organization for the local cotton industry. Research and development a ctivities. Price support, commercial and export services to growers, processors and textile manufact urers. |
| |
| |
| cotton, corporation |
| (SLD : gov.in) |
|
| zum Seitenanfang ↑ |
| Central Silk Board |
| Home |
| http://www.indiansilk.kar.nic.in/ |
| India. Statutory organization under the Government of India, managing and overseeing research, devel opment, training and education in sericulture and silk industry. Also, technical and market consulta ncy. Information resource about silk. List of publications. |
| |
| |
| |
nic.in - rank der domain 887100 (15482 in IN)
|
|
| zum Seitenanfang ↑ |
| Wool Research Organisation of New Zealand |
| |
| http://www.woolresearch.com/ |
| Industry organization, dedicated to promoting, encouraging and funding scientific or industrial rese arch and information transfer that relates to the post harvest wool industry. List of member compani es and institutions. Information about research and education activities. |
| |
| |
| research, google, feeddiv, feedcontrol, wxsessionid, industry, zealand, document, feeduri, function, location, projects, window, onload, 1c3a0559512440699ac0a1c2e7d01948, feedtitle, loadfeed, possible , rendergoogleajax, industry, farming, target, loadfeed, options, version, variable, pagetracker, cu rrent, initialise, projects, organisation, global, gajshost, milestones, reported, welcomed, contest able, harvest, collaboration, demonstrable, return, funded, leveraged, failure, market, principles, attempt, likely, determine, ensure, relevance |
| (SLD : woolresearch.com) |
|
| zum Seitenanfang ↑ |
| Cooperative Research Centre for Wool |
| Woolwise.com |
| http://www.woolwise.com/woolcrc/main.html |
| Australia. Non-profit venture between government, universities and industry, dedicated to research a nd education on wool fiber, applications and processing technologies. |
| woolwise |
| woolwise |
| research, woolwise, university, education, industry, research, quality, premium, education, cooperat ive, activities, australia, australian, centre, evaluation, educational, government, program, progra ms, universities, achievements, information, woolwise, publication, obtained, people, impact, struct ure, processing, understanding, weight, diameter, improved, performance, identified, climate, innova tive, undergraduates, vocational, mediterranean, strength, increase, staple, trainees, research, pro file, participants, achievements, available, programs, program |
| (SLD : woolwise.com) |
|
| zum Seitenanfang ↑ |
| VALAGRO. Valorizing Renewable Resources |
| Valagro Carbone Renouvelable Poitou-Charentes |
| http://www.valagro-rd.com |
| France. Research and development center for the industrial valorization of renewable resources, focu sed on vegetable oils and fibres. English and French. |
| |
| |
| eacute, valagro, renouvelable, poitou, carbone, charentes, carbone, renouvelable, valagro, technolog ique, veloppement, carbone, chimie, gajshost, document, pagetracker, industriels, biotechnogies, tec hnique, conseil, huiles, veille, transfert, lignocellulose, biomat, industriel, disposition, agrave, consulting, plateforme, centre, expertise, innovants, technologiques, avenue, recteur, pineau, ress ources, centre, recherche, poitiers, contact, valagro, faisabilit, recherche, labellis, optimisation , association, partenariat, laboratoire, timeout |
| (SLD : valagro-rd.com) |
|
| zum Seitenanfang ↑ |
| Southwestern Cotton Ginning Research Laboratory |
| ARS : Home |
| http://www.swcgrl.ars.usda.gov/ |
| USA. Research institution established by the US Department of Agriculture, focused on the study and development of solutions to ginning problems involving irrigated high-quality long and extra-long st aple cotton. Description of the ginning process. List of publications. |
| |
| |
| function, return, webtrends, onsitedoms, research, document, research, length, regexp, window, infor mation, version, cookie, prototype, privacy, quality, cookies, cmatch, statement, location, tolowerc ase, dlatest, namelen, search, enabled, indexof, recovery, modifiable, downloadtypes, project, scien tific, agricultural, partnerships, science, redirect, dcsext, images, locations, others, trackevents , settime, idlatest, gettime, unescape, service, premier, cmatchcount, substring, typeof, hostname, printable |
usda.gov - rank der domain 3496 (1337 in US)
|
|
| zum Seitenanfang ↑ |
| Coir Board of India |
| ::Coir Board Govt.of India:: |
| http://coirboard.nic.in/ |
| Development organization for the coir industry, established by the Indian government and involved in market promotion, research, education and training. Company directory for manufacturers and traders . List of articles on PDF files. Business statistics. Calendar of events. |
| |
| |
| updated, maintained, queries, regarding, coirboard, content, comments, centre, updated, welcome, web site, wizardz, hosted, national, informatics, designed, developed, content |
nic.in - rank der domain 887100 (15482 in IN)
|
|
| zum Seitenanfang ↑ |
| NIRJAFT. National Institute of Research on Jute & Allied Fiber Technology |
| |
| http://nirjaft.res.in/ |
| India. National institute, focused on basic and applied research and development in jute and related fibers and their applications in industrial and consumer products. |
| |
| |
| |
| (SLD : res.in) |
|
| zum Seitenanfang ↑ |
| Meat & Wool New Zealand |
| Beef + Lamb New Zealand : Home : |
| http://www.meatandwoolnz.com/ |
| Farmer owned and funded company, involved in research and development, marketing, knowledge transfer and education, and farm services for New Zealand's beef, sheep and goat meat farms, and wool produc ers. Directory of meat and wool processors. |
| Home |
| Home |
| status, showmenu, decoration, island, helvetica, menustylesub, milonic, menuname, overflow, scroll, family, 333333, market, ffffff, images, 666666, 000000, people, background, duration, events, ececec , border, related, farmer, resources, a2a2a2, northern, underline, council, zealand, technology, tra nsfer, research, consortia, initiated, referendum, projects, briefs, genetics, development, 7aa77a, specification, access, monitor, science, sections1, working, documents, library, corporate |
| (SLD : meatandwoolnz.com) |
|
| zum Seitenanfang ↑ |
| FibreCrops |
| Home Page FibreCrops.nl |
| http://www.fibrecrops.nl/ |
| The Netherlands. Institute within the University of Wageningen for strategic and applied research on natural fibres for applications in textiles and carpets, paper, composites and industrial products. |
| Fibrecrops.nl for strategic and applied research on natural fibres. Fibrecrops.nl is part of Biobase d Products of WUR |
| fibres, fibers, fibrecrops, fibercrops, fibre crops, fiber crops, natural fibres, natural fibers, no n-food crops, biobased, sustainable, renewable, research, industrial commodities, consumer products, product innovation, process innovation, bioeconomy, bio-economy |
| products, contact, fibres, facilities, fibrecrops, publications, projects, methods, covering, mattin g, pillows, wrapping, labels, packaging, textiles, upholstery, matresses, fabrics, carpets, involved , product, innovation, process, tissues, composites, boards, commodities, industrial, biobased, fitt ing, important, cotton, belong, economy, welcome, consumer, corrugated, applied, century, sustainabl e, renewable, resource |
| (SLD : fibrecrops.nl) |
|
| zum Seitenanfang ↑ |
| CRC. Cotton Cooperative Research Centre |
| Narrabri: Myall Vale, NSW (Australian Cotton Research Institute) (Profile - Location) |
| http://www.csiro.au/places/ps8a.html |
| Australia. Center for research, development, education and training in the cotton growing and proces sing industries. Calendar of events. Cotton management tools. Industry and weather information. Link s to related sites. |
| CSIRO’s Cotton Research Unit at the Australian Cotton Research Institute (ACRI) near Narrabri, NSW, is CSIRO’s hub of cotton research. |
| Narrabri, cotton, Australian Cotton Research Institute, CSIRO Plant Industry, cotton research, ACRI, Cotton Research Unit, cotton breeding, |
| cotton, flagship, research, australian, national, research, materials, management, minerals, energy, technologies, health, narrabri, cotton, climate, science, science, centre, mining, astronomy, austr alia, information, institute, collection, engineering, marine, sustainable, change, national, manufa cturing, oceans, contact, enquiries, transport, understanding, exploration, environments, metals, sy stems, coasts, communication, opened, animal, processing, industries, process, facilities, external, control, public, facilities |
www.csiro.au - rank der domain 136629 (856 in AU)
|
|
| zum Seitenanfang ↑ |
| Bangladesh Jute Research Institute |
| |
| http://www.bjri.gov.bd/ |
| Government institute dedicated to basic and applied research on jute and allied fibers, jute and tex tile product development, and economic and market research. |
| |
| |
| |
| (SLD : gov.bd) |
|
| zum Seitenanfang ↑ |
| Cotton Foundation |
| The Cotton Foundation |
| http://www.cotton.org/foundation/ |
| USA. Research and education arm of the North American cotton growers associations and allied industr ies. Library of technical studies and research articles. |
| |
| |
| verdana, helvetica, family, weight, foundation, cotton, cotton, linkbar, normal, 0033cc, research, d ecoration, members, ff0000, solutions, projects, education, 000000, supported, information, technolo gy, production, series, contact, harvest, chairman, reference, general, nccxsmall, quarterly, journa l, science, several, efficient, fundamental, insects, topics, source, providing, comprehensive, mana gement, chlorosis, subject, induced, waterlogging, weevil, eradication, program, history, article, p eople |
cotton.org - rank der domain 794776 (317380 in US)
|
|
| zum Seitenanfang ↑ |
| Institute of Agriculture and Natural Resources |
| Institute of Agriculture and Natural Resources |
| http://ianrhome.unl.edu |
| USA. From the University of Nebraska. Research department. Use search to reach information on fibers for textiles and nonwovens. |
| |
| |
| instance, display, padding, border, nebraska, bottom, margin, resources, content, expander, backgrou nd, agriculture, natural, college, inline, zenbox, lincoln, institute, faculty, extension, weight, d ecoration, jquery, author, javascript, description, education, cropwatch, quality, economy, height, repeat, comments, research, university, templates, cdcdcd, agricultural, underline, sciences, normal , administration, support, appear, browser, conservative, independent, production, provides, televis ion, survival |
unl.edu - rank der domain 14089 (5245 in US)
|
|
| zum Seitenanfang ↑ |
| Bangladesh Sericulture Research and Training Institute |
| .:: Bangladesh Sericulture Research and Training Institute ::. |
| http://www.bsrti.gov.bd/ |
| Independent research organization within the Bangladesh Ministry of Textiles and Jute, involved in a pplied research on indigenous and exotic varieties of silkworm races. List of on-going projects. |
| Website of Sericulture Research and Training Institute. |
| Sericulture Research and Training Institute,Vision & Mission,Strategies,Activities,Projects,Achievem ent,About Us,Photo Gallery,Sitemap, Contact Us |
| search, window, status, directories, height, resizable, return, dependent, scrollbars, search, strat egies, mission, vision, activities, projects, copyrigh, target, achievement, location, hiding, tuesd ay, contact, sitemap, gallery, document, custom, google, research, sericulture, bangladesh, training , institute, opennewwindow, function, textile, sitesearch, menubar, popupwin, 96655def2451ac26, cent er, coronait, toolbar |
| (SLD : gov.bd) |
|
| zum Seitenanfang ↑ |
| USDA-ARS Cotton Ginning Research Unit |
| Cotton Ginning Laboratory(Stoneville, MS) : Home |
| http://www.ars.usda.gov/main/docs.htm?docid=3379 |
| US Department of Agriculture Agricultural Research Service unit, dedicated to discover, develop, and evaluate basic and applied principles useful for storing, conditioning and cleaning seed cotton, se parating lint from seed, cleaning and packaging lint, controlling the ginning process; collecting an d disposing of byproducts, and reducing air and noise pollution incident to ginning. Detailed descri ption of the principle and workings of a cotton gin. |
| |
| |
| function, return, stoneville, webtrends, onsitedoms, cotton, ginning, length, document, cookie, rese arch, statement, prototype, laboratory, version, window, regexp, indexof, enabled, cookies, modifiab le, tolowercase, dlatest, namelen, cmatch, downloadtypes, trackevents, dcsext, images, idlatest, set time, cmatchcount, dcsgetid, wtloptout, dcsgetcookie, gettime, unescape, hostname, typeof, dcssplit, location, acookie, substring, dcsgetcrumb, redirect, fpcdom, station, experiment, careers, personne l, information |
usda.gov - rank der domain 3496 (1337 in US)
|
|
| zum Seitenanfang ↑ |
| Australian Wool Innovation, Ltd |
| AWI - wool.com - Australian Merino Wool Industry. |
| http://www.wool.com |
| Research, development and innovation institute owned by Australian woolgrowers. List of publications and educational programs. Facts and figures about wool, and the Australian wool market. |
| |
| |
| february, january, december, november, august, october, september, merino, australian, gslider, inno vation, market, design, casual, comfort, images, addimage, spinexpo, publications, harvest, innovati ons, gajshost, javascript, finishingknittingweavingmaking, document, pagetracker, woolgrowers, centr e, showcased, natural, wearing, natural, finishes, textures, unique, contentfontsize, industry, coll ections, merinotouch, merinocasual, conditions, copyright, finishing, knitting, reserved, privacy, p olicy, selection, topmaking, rights, dyeing |
wool.com - rank der domain 736727 (5134 in AU)
|
|
| zum Seitenanfang ↑ |
|
