| California Trailer and RV Sales |
| California Trailer & RV Sales, Inc. > Home |
| http://www.californiarvsales.com/ |
| Located in Redding. Offers trailer and RV sales and rentals plus service. |
| |
| |
| service, trailer, california, accessories, trailers, department, camping, convenience, department, c amping, available, budget, coleman, repair, within, center, brands, knowledgeable, insurance, friend ly, complete, accessories, appliances, redding, converters, outdoors, accessory, affordable, chairs, location, circuit, boards, including, cleaning, chemicals, batteries, furnaces, conditioners, heate rs, electrical, plumbing, repairs, wheels, welding, heaters, conditioners, furnaces, fiberglass, com panies, california, trailer |
| (SLD : californiarvsales.com) |
|
| zum Seitenanfang ↑ |
| Custom RV |
| Home |
| http://www.customrvsales.com |
| Located in Anaheim. Offers sales of new RVs plus new and used trailers plus service and rentals. Inc ludes a list of upcoming shows and product specifications. |
| This web site has been created with technology from Avanquest Publishing USA, Inc. |
| Web Easy, Avanquest |
| trailmanor, inventory, chalet, elkmont, sleeps, weighing, trailmini, expands, highly, successful, ta kena, customrvsales, products, photos, customer, financing, gretta, anaheim, department, service, sc hedule, details, sunday, spring, memories, saturday, through, monday, operation |
| (SLD : customrvsales.com) |
|
| zum Seitenanfang ↑ |
| Fredericks Unlimited |
| Fredericks Unlimited RV Sales, Home Page |
| http://fredericksunlimited.com |
| Located in Paso Robles. Offers sales of used motorhomes, travel trailers, 5th wheels, and slide in c ampers. |
| Fredericks Unlimited RV Sales. Conveniently located in Paso Robles, CA with easy Highway 101 access. We specialize in new and used RV sales. We are proud to carry Sierra and Salem by Forest River, Fun Finder X and Fun Finder Xtra by Cruiser RV and Lance Truck Campers. Come in and view our great sele ction of RVs and experience our unbeatable service! |
| Fredericks Unlimited, RV Sales, used rv sales, Paso Robles, CA, Highway 101, Sierra, Salem, Forest R iver, Fun Finder X , Fun Finder Xtra, Cruiser RV, Lance ,Truck, Campers, |
| frederick, comments, contact, interesting, reviews, trailers, unlimited, fredericks, services, trave l |
| (SLD : fredericksunlimited.com) |
|
| zum Seitenanfang ↑ |
| Business/Automotive/Recreational_Vehicles/Retailers/North_America/United_States/California |
|
|
| Business/Automotive/Recreational_Vehicles/Retailers/North_America/United_States/California |
| zum Seitenanfang ↑ |
| Giant RV |
| New and Used RVs for sale, Travel Trailers, Fifth Wheel RVs at Giant RV your #1 Dealer |
| http://www.giantrv.com/ |
| Locations in Upland, Corona, and Irvine. Offers sales of new and used RVs plus parts and service. In cludes product information. |
| |
| |
| travel, haulersused, trailer, requestproduct, wheelsused, motorized, trailersfactory, rvfeatured, dr ivewe, rvsdisclaimer, usfinancingfly, serviceabout, rverswhy, gasused, rvlocationsparts, brandsnew, trailersnew, trailers, dealer, haulersnew, trailersused, wheelsnew, dieselnew, gasnew, dieselused |
giantrv.com - rank der domain 754725 (333396 in US)
|
|
| zum Seitenanfang ↑ |
| Happy Daze RV |
| California New & Used Motorhomes & RVs: Tiffin Allegro Motorhome, Keystone RV for Sale, Rental, Parts & Class A Motor Home Service in Sacramento, CA - Travel Trailers, Fifth Wheels & Toy Haulers |
| http://www.happydazerv.com/ |
| Located in Sacramento. Offers sales of new and used RVs plus service and rentals. Includes rental ra tes and used inventory listing. |
| Happy Daze RVs is an RV dealer in Sacramento, California offering new and used RVs, Class A & C moto rhomes, fifth wheels & travel trailers for sale. Shop Allegro, Tiffin & Keystone motor homes as well as motorhome rental, parts & service in CA. |
| Happy Daze RV's, Happy Days RV, California, CA, Sacramento, Northern, RV, RVs, Motorhome, Motorhomes , Motor Home, Motor Homes, Dealer, Dealers, Dealership, Sales, Service, Parts, Rental, New, Used, Cl ass A, Class C, Allegro, Tiffin, Phaeton, Bus, Astoria, Damon, Four Winds, Fourwinds, Lance, Tuscany , Windsport, Zinger, Keystone, Challenger, Everest, Outback, Sydney, Springdale, Sprinter, Raptor, C rossroads, Cruiser, Kingston, Sunset Trail, Fun Finder, ViewFinder, Dutchmen, Komfort, Trailblazer, R-Vision, RVision, For Sale, RV Show, Cal Expo, Travel Trailer, Travel Trailers, Fifth Wheel, Fifth Wheels, 5th Wheel, 5th Wheels, Camper, Campers, Truck Camper, Toy Hauler, Toy Haulers, Lite Weight |
| images, document, motorhomes, dealersite, psndealer, happydazerv, california, blendtrans, travel, mo torhome, trailers, function, onload, slideshow, slideshow2, diesel, keystone, filter, duration, filt ers, preload, length, motorhome, service, sacramento, preload2, tiffin, allegro, northern, window, s election, settimeout, scrollmsg, crossfadeduration, wheels, slideshowspeed, rental, haulers, pusher, dealer, phaeton, looking, factory, request, trained, komfort, dutchmen, seconds, finder, assist, fi fthwheels |
| (SLD : happydazerv.com) |
|
| zum Seitenanfang ↑ |
| Mike Thompson's RV Super Stores |
| Southern California RV Dealer | Mike Thompson's RV Super Stores | |
| http://www.mikethompson.com |
| Locations in Santa Fe Springs, Colton, and Fountain Valley. Offers sales of new and used RVs plus se rvice, parts, and accessories. |
| Mike Thompson RV is a RV Dealer. Specializing in used rv sales and new rv sales in Southern Californ ia for Alfa, Fleetwood, Four Winds, Itasca, Keystone, Mandalay, Outlaw and Siena RV Brands. |
| rv dealer,used rv sales,rv sales,used rv,Southern California RV sales,motorhome,travel trailer,rv pa rts,rv classifieds,fifth wheel,rv |
| thompson, cougar, outback, allegro, tiffin, diesel, georgetown, redline, country, edition, raptor, s ydney, fuzion, hyperlite, bounder, outlaw, trailer, passport, springdale, energy, travel, motorhomes , navion, latitude, customers, forest, fiesta, trailers, formula, montana, motorhome, stores, functi on, circle, excellence, locations, drupal, phaeton, prices, pagetracker, coleman, sunday, service, k eystone, mandalay, financing, attachment, service, itasca, matter, windsport |
mikethompson.com - rank der domain 601103 (270276 in US)
|
|
| zum Seitenanfang ↑ |
| Everything RV |
| Range RV | Hesperia California RV Dealer |
| http://www.rangerv.com |
| Located in Hesperia. Offers motorhomes, travel trailers, and fifth-wheels. Includes online parts and accessories catalog. Service also available. |
| |
| Rv dealer, dealer, fifth wheels, fifthwheels, trailer, motorhomes, rvs, Victorville, Hesperia, apple valley, Adelanto, phelan, oaks hills, high desert, high desert rv dealer, local rv dealer, rentals, motorhome rentals, rv rentals, trailer rentals, M |
| jquery, inventory, trailers, hesperia, function, wheels, scrollable, 92345local, mariposa, interval, travel, specials, slideshowbegin, service, dealer, california, provide, promote, services, featured , itascaimpulseeclipseattitudeotherinterstatecoachmencaptivaskylinerampageeclipseattitude, complete, desert, rights, reserved, privacy, copyright, policy, unsubscribe, ultimate, showcase, development, website, design, rv11626, 9980fax, 8919range, marine11626, manufacturer, clsscroll, trailer, monaco camelotskylinerampageskylinealjothor, californiatahoemonacolapalmamonacodiplomat, companies, quality , mfcscroll, welcome, diesel, greybox, starburst, display |
| (SLD : rangerv.com) |
|
| zum Seitenanfang ↑ |
| Sky River RV |
|
| http://www.skyriverrv.com |
| Located in Paso Robles. Offers new and used sales. Includes photos. |
| |
| |
| |
skyriverrv.com - rank der domain 989134 (14860 in EU)
|
|
| zum Seitenanfang ↑ |
| Business/Automotive/Recreational_Vehicles/Retailers/North_America/United_States/California |
|
|
| Business/Automotive/Recreational_Vehicles/Retailers/North_America/United_States/California |
| zum Seitenanfang ↑ |
| Traveland USA |
| Motorhomes, Toy Haulers, Fifth Wheels, Travel trailers, Tent Trailers, Truck Campers, Southern California |
| http://www.travelandusa.com |
| Located in Irvine, offering a collection of dealers and a service center. Includes a dealer list, FA Q and service information. |
| New and used Motorhomes, Mini Motorhomes, Travel trailers, Fifth Wheels, Tent Trailers, Truck Camper s, Toy Haulers, Camper Shells and Bed Covers Irvine,CA Home of Califonia RV Dealers |
| motorhome,motor home,travel trailers,fifth wheels,camper shells,toyhauler,toy haulers,rv,rental,trav elandusa,traveland,travelland,usa,california,dealers |
| traveland, motorhomes, trailers, vacation, travel, family, service, largest, location, wheels, irvin e, storage, motorhome, location, shopping, pagetracker, haulers, california, campers, pricing, wheth er, purchase, personal, everyday, contact, privacy, information, family, mcmahon, document, gajshost , luggage, security, vacation, destinations, reasons, dealer, experience, friends, directions, selec tion, anywhere, motorhome, center, largest, trailer, travel, shopping, directory, dealers, worlds |
travelandusa.com - rank der domain 940224 (0 in US)
|
|
| zum Seitenanfang ↑ |
| Camper and Trailer Outlet |
| RV sales, consignments, and rentals of truck campers travel trailers, tent trailers, toy haulers, vans and trucks. Dealer locations in Orange County and San Diego County |
| http://camping-trailers.com |
| Locations in Santa Ana and El Cajon. Offers tent trailer rentals and sales plus sales of truck campe rs and travel trailers. |
| RV sales, consignments, and rentals of truck campers travel trailers, tent trailers, toy haulers, va ns and trucks. Dealer locations in Orange County and San Diego County. |
| trailer consignment,rv rentals,starcraft,rockwood,rv dealers san diego,rv dealers orange county,rv s ales,santa ana,el cajon,san diego,orange county,orangecounty,trailer consignment,motorhome rentals,c amperrentals,hilo trailers,lance,aliner,wildwood,trailmanor,adventurer,toyhaulers,alpenlite,campers, trailers,travel trailers,tent trailers,toy haulers,slide in campers,truck campers,trailer,sandpiper toy haulers,forest river,viking,coachmen,camper,los angeles,calif,ca,trailer rentals,rent trailers,c amper outlet,tent trailer rentals,folding trailers,folding campers,sun-lite,sunlite,keystone,keyston e,roadrunner,motorhomes,sunvalley,sun valley,eagle campers,alpenlite voyager,alpenlite fifth wheel,p op-up,slide-in,popup,used trailers, |
| margin, family, rentals, weight, county, trailers, button, bottom, series, campers, background, oran ge, ffffff, travel, department, trailer, rental, camper, decoration, service, campers, exclusive, fe atures, standard, picture, camper, information, rentals, consignments, includes, standard, southern, california, 1965444, urchintracker, dealers, selection, trailer, outlet, location, announce, introd uction, addition, pictures, repair, helvetica, style6, style4, 0066ff, hauler, consign |
camping-trailers.com - rank der domain 981319 (403133 in US)
|
|
| zum Seitenanfang ↑ |
| Family RV |
| RV rentals, RV sales, RV consignment, RV service San Jose, California |
| http://www.familyrv.com/ |
| Located in San Jose. Offers sales, service, parts and rentals. Includes live inventory and a consign ment program. |
| motorhome rv rental special, trailer rental, motorhome sales, rental motor home san jose california, rv sales san jose, rv service, rv rentals northern california, winnebago motorhomes, motor home re ntals, travel trailer rentals |
| rv rental, rv rentals, rent rv, rvs, renting camper camper, campers, camping motor home home, homes, motorhome motorhome, motorhomes, travel trailer, trailers, |
| document, function, rentals, gravity, attitude, crossover, articles, trailer, wheels, commercial, ha ulers, diesel, vehicle, trailers, pushers, swapimgrestore, glatlng, loadmap, gbrowseriscompatible, s etcenter, getelementbyid, directions, testimonials, company, mailing, service |
familyrv.com - rank der domain 970870 (18203 in CA)
|
|
| zum Seitenanfang ↑ |
| Magic Touch RVs |
| Magic Touch RV's- New & Used Trailers, 5th Wheels, Toy Haulers & Motor Homes |
| http://www.magictouchrv.com/ |
| Located in Tulare. Offers sales of new and used motor homes, trailers and fifth wheels, plus service and accessories. Includes online shopping feature. |
| |
| |
| trailers, haulers, wheels, travel, dealer, sandstorm, wildwood, rampage, layton, accessories, invent ory, wildcat, freestyle, tulare, recreational, california, service, skyline, central, authorized, ve hicle, forest, copyright, contact, selection, internet, trucks, campers, located, authorized, vehicl es, catalog, online, specials, welcome |
| (SLD : magictouchrv.com) |
|
| zum Seitenanfang ↑ |
| Manteca Trailer and Motorhome |
| California RV Dealer -Manteca California RVs, Motorhomes, Fifth Wheels, and Travel Trailers- Manteca Trailer |
| http://www.mantecatrailer.com/ |
| Located in Manteca. Dealer of a variety of RVs and trailers including National, Airstream, Jayco, an d Skyline. |
| Manteca Trailer is a premier California RV Dealer featuring Airstream, Jayco, Lance, Komfort, Nation al RV and Newmar, and a large inventory of used products of all RV makes and models. Find the RV, mo torhome, fifth wheel, toy hauler, travel trailer or camper of your dreams on our website or stop in at one of the largest California RV Dealer locations |
| Manteca, Trailer, RV dealers in california, rv dealer california, rv dealers california, california rv dealer, california rv dealers, RV Show Pleasanton, RV Show California, January RV Show, Californi a, California RV, Northern California, Central Valley RV, Central Valley, Camper, RV, RVs, dealer, A irstream, Jayco, Dutchstar, Komfort, National RV, Newmar, Campers, Truck campers, tent trailers, pop -up trailers, pop-ups, trailers, travel trailers, fifth wheels, park models, motorhomes, Class A, Cl ass B, Class C, Diesel pushers, Diesel motorhomes, Recreational Vehicles, Recreation, Vacation, fami ly fun, Outdoors, Qwest, Eagle, Heritage, Jayflight, Kiwi, Dutch Star, towable RVs, motorized rvs, U sed RVs, New RVs |
| manteca, california, trailer, service, selection, travel, service, motorhomes, trailers, yosemite, d ealer, largest, customers, quality, provide, experience, series, manufacturers, heartland, service, motorhome, northern, wheels, please, bighorn, 3055rl, 995sale, 276sale, feather, contact, conditions , sunday, websites, interactrv, through, purchased, expert, installation, specialty, greyhawk, power ed, motorhome, directory, campsite, replacement, manteca, contact, history, consignment, closeouts, detail |
mantecatrailer.com - rank der domain 933113 (338147 in US)
|
|
| zum Seitenanfang ↑ |
| Village RV |
| New & Used RVs for Sale in Sacramento California | Motorhomes, Campers, Travel Trailers & Fifth Wheels from Village RV - Roseville, CA - Village RV |
| http://www.villagerv.com/ |
| Located in Roseville. Offers sales of new and used motorhomes, trailers, and fifth wheels plus a par k and service facility. |
| Camping World of Sacramento California, America's Largest RV Dealership selling New and used RVs, Tr avel Trailers, Motorhomes and 5th Wheels. The name you trust with over 85 dealers nationwide providi ng RV Parts, RV Service and RV Accessories. |
| Village RV, Sacramento RV Dealer, rv dealer, dealer, rv sales, sales, used rv, used rvs, new rv, new rvs, rv service, service, rv parts, parts, Roseville, Sacramento, california, california rv dealer, northern california rv dealer, class A, class A RV, class C, class C RV, class B RV, diesel, Diesel pusher, travel trailer, toy hauler |
| campers, motorhomes, travel, trailer, coleman, dutchmen, keystone, secondtracker, freedom, itasca, d iesel, hybrid, winnebago, chalet, camping, pagetracker, fleetwood, forest, laredo, village, rosevill e, spirit, georgetown, center, greyhawk, junction, colorado, document, bounder, location, gajshost, cherokee, expedition, springdale, navion, suncruiser, kodiak, fourwinds, specials, initdata, trackpa geview, insurance, gettracker, service, search, wheels, fsu240, setallowlinker, ctf259re, 298bhl, em ployment |
| (SLD : villagerv.com) |
|
| zum Seitenanfang ↑ |
| JC's RV's |
| Bay Area RV Dealer | Sales | New | Used | California |
| http://jcsrvsinc.com |
| Located in Livermore. RV sales, rentals and parts. |
| Bay area new and used RV sales. We offer RV storage. JP is a great pit stop before you leave town on your RV trip this year. Forest River sales for Northern California |
| bay area RV, sales, storage, gulf stream, forest river, used rv |
| livermore, center, pagetracker, california, northern, airway, gajshost, document, experience, friend ly, coming, finance, storage, dealer, employees, visiting, america, pleasanton, corporate, fremont, mistake, leandro, francisco, including, unfortunate, hayward, oakland, offices, supported, customers , former, blessing, formed, lending, concern, greatest, grounds, javascript, 3cscript, unescape, goo gle, analytics, script, setallowlinker, trackpageview, setdomainname, gettracker, 5616033, surroundi ng, rights, richmond |
| (SLD : jcsrvsinc.com) |
|
| zum Seitenanfang ↑ |
| Richardson's RV Centers |
| Jayco RV Dealer : California Dealers : RVs For Sale |
| http://richardsonsrv.com/ |
| Locations in Riverside, Temecula, and Sun City. Lists brands available, store locations, online part s ordering. Also has a used inventory and acts as an intermediate between banks and buyers for repos sessed RVs. |
| |
| |
| dealers, california, dealer |
richardsonsrv.com - rank der domain 780261 (335965 in US)
|
|
| zum Seitenanfang ↑ |
| Bria Recreation |
| Bria Recreation Home Page |
| http://www.briarecreation.com |
| Located in Santa Rosa. Sells motorhomes and folding trailers. |
| Bria Home Page |
| RV, RVs, motor homes, motorhomes, motor home, motorhome, travel trailer, camping trailer, folding tr ailer, tent trailer, hybrid trailer, expandable trailer, Fleetwood, Coleman, Jayco, Starcraft, Lance , Northstar, Texson, Aerolite, Cub, Zoom, Rockwood, Roo |
| recreation, avenue, located, yolanda |
| (SLD : briarecreation.com) |
|
| zum Seitenanfang ↑ |
| Holland Motor Homes |
| Holland Motor Homes |
| http://www.hollandmotorhomes.com/ |
| Located in San Diego. Sells and services a variety of motor homes. |
| Located in San Diego, CA, Holland Motor Homes sells and services a variety of new and preowned, used motorhomes and recreational vehicles (RVs) including Country Coach, Holiday Rambler by Monaco, Flee twood, Roadtrek Camper Van, Newell Coaches and Krystal Luxury Coaches. |
| Motorhomes, Motor homes, Motorhome, motor home, recreational vehicles, recreational vehicle, RV, RVs |
| display, document, manager, dvrequest, dvsignup, dvvideo, inline, getelementbyid, specials, service, service, videos, function, holland, locations, contact, showroom, arturo, inventory, business, moto rhomes, pagetracker, hollandmotorhomes, contamos, gajshost, quality, opportunity, appreciate, equipo s, nosotros, mexico, puestos, selection, invitamos, comuniquen, choose, amigos, gracias, shopping, b efore, ustedes, pronto, primer, vacacionar, purchase, hablar, espero, libertad, search, provides, fa cility |
| (SLD : hollandmotorhomes.com) |
|
| zum Seitenanfang ↑ |
| Banning RV Discount Center |
| New & Used RV Sales California - Travel Trailers, Fifth Wheels, Folding Campers, Toy Haulers & Motorhomes | RV Discount Centers of California |
| http://www.discountrvs.com/ |
| Located in Bannning. Sells new and used RVs and also offers parts and service. Includes specificatio ns and floorplans. |
| RV Discount Centers is southern California's low price RV dealer. Our inventory includes, but not li mited to, new and used Forest River 5th wheels and toy haulers, Alpenlite Recreational Vehicles, Vo rtex by Thor. |
| Banning RV, Discount Center, RV, RVs, Recreational Vehicles, California, CA, Southern California, Ri verside County, San Bernardino County, Orange County, Los Angles County, San Diego County, Kern Coun ty, Travel Trailers, Fifth Wheels, 5th Wheel, New, Used, Folding Camper, Campers, Folding Tent Campe r, Toy Hauler, Motorhomes, Motor Home, Dealer, Dealership, Sales, Service, Parts, Accessories, For S ale, Aliner, Salem, Sierra, Sandpiper, Wildwood, Forest River, Alpenlite, Vortex, Thor, Attitude, Ec lipse, Cardinal, Rockwood, Buy, Stellar, Toyhauler, toyhauller, Toybox, RV Camper, Dunes, Glamis, su nseeker, sun seeker, class c, motorhome, motorhomes, moterhome, classc, cheap, deal, light, lite wei ght trailer, superlight, featherlight, featherlite, Z-gravity, lightning, sandstorm, shockwave, stea lth, weekend warrior |
| images, document, california, psndealer, dealersite, discountrvs, onload, discount, function, center s, slideshow, window, southern, blendtrans, preload, length, scrollmsg, slideshowspeed, duration, fi lter, runslideshow, filters, settimeout, substring, haulers, software, boldchat, forest, wheels, ser vice, locations, motorhomes, locations, service, trailers, wheels, beaumont, customers, travel, visi stat, location, crossfadeduration, powersportsnetwork, sunseeker, factory, sandstorm, shockwave, spo nsored, industry, setflashheight, rockwood |
discountrvs.com - rank der domain 976749 (377638 in US)
|
|
| zum Seitenanfang ↑ |
| Almaden R.V. Service & Repair |
| Home |
| http://almadenrv.com |
| Located in San Jose. Provides service for appliances, awnings, air conditioners, toilets, and exteri ors. |
| |
| |
| closed, service, complete, geovisit, almaden |
| (SLD : almadenrv.com) |
|
| zum Seitenanfang ↑ |
| Charlie's R.V. Body and Fiberglass Repair |
| Charlie's R.V. Body & Fiberglass Repair |
| http://charlie_g_redard.tripod.com/CharliesRV |
| Located in Buena Park. Provides mobile service for body and fiberglass repairs on RVs. |
| |
| |
| height, background, social, images, position, repeat, important, window, search, container, margin, document, button, padding, display, jquery, tripod, category, decoration, function, section, sprite, relative, onbutton, adbanner, documentelement, repair, onsearch, onshare, service, setforcedparam, clientwidth, center, animate, hidden, return, because, services, normal, clientheight, repair, absol ute, replace, charlie, family, contain, helvetica, overflow, underline, cursor, pointer |
tripod.com - rank der domain 857 (45 in JP)
|
|
| zum Seitenanfang ↑ |
| Inland RV Center |
| Inland RV Center - The Nations Leading Expert in Airstream Innovations |
| http://www.inlandrv.com |
| Located in Corona. Service center specializing in Airstream products. |
| |
| |
| airstream, center, inland, source, product, innovations, henschen, download, pleased, innovations, c reativity, expertise, better, balancers, centramatic, jackson, distributors, inquiries, dealer, welc ome, public, exclusive, national, appointed, industrial, imagination, because, argosy, announce, sep tember, elizabeth, office, corona, quarter, expert, leading, nations, projects, testimonials, contac t, stories, photos, articles, enthusiasts, experience, enticed, hundreds, directions, service, leadi ng, expert |
| (SLD : inlandrv.com) |
|
| zum Seitenanfang ↑ |
| Iowa Boys |
| Iowa Boys, LLC - Vintage Trailer Sales & Restoration 818-764-4796 |
| http://iowaboys.com |
| Located in North Hollywood. Offering sales of used and vintage trailers and RVs plus tent trailer an d studio rentals. Also accepts consignments. |
| Iowa Boys, LLC Vintage Travel Trailers, restoration, sales, service. Located in N. Hollywood, CA |
| Iowa Boys, Iowa Farm Boys, vintage travel trailers, trailers, vintage, travel, repairs, antique, res toration, parts, airstream, Airstream, trailers, used, rv, rv's, studio, rentals, for, sale, Boles A ero, Traveleze, Clipper, Silver Streak, Streamline, Aljo, Aljoa, Spartan, Spartanette, Shasta |
| rentals, studio, restorations, trailer, vintage, western, gaskets, window, related, available, amazo n, member, visited, questions, comments, please, updated, drawings, browse, webring, restorations, c alifornia, refurbish, restore, catalogs, utility, repair, trailers, outstanding, restoration, traile r, continuing, tradition, travel, original, recent, repairs, photos, projects, utility, information, television, pictures, studio, rentals, address, motion, servicing, experience |
| (SLD : iowaboys.com) |
|
| zum Seitenanfang ↑ |
| Advantage RV |
| advantage rv |
| http://advantage-rv.com |
| Offers mobile RV repair service for Los Angeles, San Bernardino, Riverside, and Orange counties in s outhern California. Specializes in refrigerators, cooling units, and heating elements. Contact infor mation. |
| Advantage rv Mobile rv repair serving Orange, San Bernardino, LA, Riverside counties in Southern Ca lifornia. Full spectrum HD on DISH Network, KVH, Tracstar, Winegard MINIMAX Dome style Satillites. D irect TV full Spectrum HD on Traveler Winegard,Tracstar satellite systems, New HD, DVB, In motion, s oftware upgrades. Splendide 2000s,2100 and 2100xc 6200cee,7100xc washer/dryers and the new stackable Ariston by splendide. refrigerators and cooling unit. all types of repairs. Have our mobile unit co me out to install or repair your satellite system where ever you are. The Advantage is yours,We come to you! |
| 2010 KVH LOW PROFILE SATELLITES ,KVH, WINEGARD, Satillite systems,Advantage RV Splendide washer dr yers 2100s, 2100xc, 6200cee ,Dish network full spectrum HD with KVH satellites,Splendide washer and dryers,Winegard minimax HD Satillites,RV Satellite repair southern Calif,Mobile rv satellite repair kvh,motosat,tracstar, winegard in southern CA,Tracstar satellite repair,Splendide 2100xc washer dr yers,Advantage RV New kvh satellite systems R4, R5,R6 and A7 mobile satellite systems installed,M obile RV repairs in southern california,Advantage RV KVH , Winegard Satelllites upgrades and repai rs,Splendide by Ariston stackables ,Winegard Satellite systems,KVH HD,DVB satellite sales and servi ce,NEW KVH TRACVISION SATELLITE,Advantage RV KVH R4sl and R5sl Satellites ,RV satellite systems, S an Bernardino, Orange, LA, Riverside counties in southern CA ,Mobile rv Satellite mobile sales and service center in southern ca , |
| winegard, systems, trailers, service, network, washer, digital, motion, spectrum, satellite, satelli tes, mobile, vented, leveling, factory, stationary, splendide, refrigerators, install, repair, versi on, network, picture, direct, freedom, nomad2, executive1, motosat, motion, stacks, mv3500a, 2100xc, stackable, ariston, upgradeable, stackable, tracstar, mv3500t, pricingor, replacementon, component, lippert, barker, insurance, extended, southern, warrantiesserving, dewald, powergear, because, cali fornia |
| (SLD : advantage-rv.com) |
|
| zum Seitenanfang ↑ |
| Brown's RV |
| California RV Sales, Fifth Wheels Travel Trailers Northern CA, Lower Lake RV, Ukiah RV, Santa Rosa Recreational Vehicle Dealer |
| http://www.brownsrv.com |
| Located in Lower Lake. Sells new and used RVs and offers service and parts. |
| Sacramento RV Center, Northern CA Fifth Wheels, Green RV Lite Trailer Sales,
Travel Trailers Ukiah , Toy Haulers Santa Rosa, Pre-Owned RV Motorhomes.Park Model Homes NorCal.Recreational Vehicle Servi ce Parts |
| Discount RV Sales Northern California, Sacramento,CA, Wholesale RV, Toy Haulers, Ramp Trailers Napa ,
Fifth, Wheels,Travel,Trailer Dealer,Used RV Santa Rosa,Pre Owned Recreational Vehicles,Green Lite RV, Consignment Trailers Lower Lake |
| service, specializing, consignment, northern, california, wheels, travel, trailers, recreational, ve hicle, saturday, function, dealer, return, welcome |
| (SLD : brownsrv.com) |
|
| zum Seitenanfang ↑ |
| Funday R.V. Service |
| FundayRV.com |
| http://www.fundayrv.com |
| RV Motorhome service and sales in San Diego California. Generator service. |
| |
| funday, Funday, FunDay, fundayrv, rv, RV, Oceanside, oceanside, San Diego, san diego, sandiego, serv ice, repair, parts, generator |
| number, fundayrv, visitor |
| (SLD : fundayrv.com) |
|
| zum Seitenanfang ↑ |
| RV Brokers |
| California RV Brokers for New and Used Motor Homes Travel Trailer RVs |
| http://rvbrokers.com |
| Located in Sacramento. Sells campers, travel trailers, fifth wheels, and motorhome and help with buy ing and selling. |
| |
| |
| popwin, usednew, trailer, bigfoot, opener, contact, motorhome, campers, brokers, popattr, popheight, popurl, popwidth, popname, travel, designed, adventure, through, constructed, comfortably, motorhom es, patented, spacious, engineered, durability, wallsystem, superb, activities, fibercore, interior, finishing, bodied, seasons, bicycles, leisure, safely, essential, require, abundant, amount, exteri or, storage, models, available, wheelsmotorhomespacific, information, workstravel, trailerstruck, wh eels, hauler, function |
| (SLD : rvbrokers.com) |
|
| zum Seitenanfang ↑ |
| Dan Gamel's RV Centers |
| |
| http://www.gamel.com |
| Largest California Fleetwood RV dealer with six locations selling and servicing new and used RVs, mo tor homes, travel trailers, diesels, fifth wheels, campers, parts and accessories. |
| |
| |
| locations |
| (SLD : gamel.com) |
|
| zum Seitenanfang ↑ |
| Leales Fleet & R.V. Center Inc. |
| |
| http://www.lealesautorv.com |
| Serving the Bay Area for auto,truck and R.V.Repairs and Service. Located in San Jose. |
| |
| |
| |
| (SLD : lealesautorv.com) |
|
| zum Seitenanfang ↑ |
| American RV Expo |
| Online RV Dealer | Southern California New and Used RV's | RV Mall |
| http://www.rvexpo.com |
| American RV Expo includes 18 sales lots on 22 acres including sales and service by 6 of California's largest RV dealers. |
| RV Expo is a new and used RV dealer located in Southern California. We sell top RV brands from the b est RV dealers. From Airstream to Fleetwood and Winnebago and more, RV Expo, your Online RV Dealer in Southern California |
| rv dealers, used rv, rv sales, used rv sales, Southern California RV sales, online RV directory, M otorhome, rv parts, rv classifieds, 5th wheel, fifth wheel, rvs, California rv dealers |
| trailer, travel, toyhauler, safari, search, bounder, rambler, coachmen, pleasure, krystal, holiday, outlaw, monaco, choose, navion, country, eclipse, dutchman, skyline, tiffin, revolution, forest, exp edition, select, roadtrek, diesel, search, options, manufacturers, jquery, itasca, manufacturer, win nebago, camper, expandable, folding, passage, destination, vectra, hurricane, journey, beaver, supre me, classic, sprinter, legend, cheetah, compression, chalet, football, fields |
| (SLD : rvexpo.com) |
|
| zum Seitenanfang ↑ |
| Canyon RV Center |
| California Travel Trailer, Fifth Wheel RV Dealer :: Canyon RV Center :: Featuring new & used towable rv from R-Vision, Komfort > Home |
| http://www.canyonrvcenter.com |
| Offers RV service and parts in Colton, San Bernardino, and Irvine. Sells new and pre-owned motorhome s, fifth wheels, travel trailers and toy haulers. |
| |
| |
| canyon, document, trailer, travel, cookie, center, escape, heartland, navigator, dutchmen, californi a, motorhome, riverside, location, bernardino, county, orange, angeles, motorhomes, select, dealer, indexof, pagetracker, window, trailers, wheels, ctldnnsolpartmenu, travel, dnnsolpartmenu, fontana, screen, redlands, moreno, valley, vision, rialto, southern, mckenzie, monaco, toyhauler, friday, len gth, posted, skyline, unescape, diesel, recreational, roadmaster, gajshost, service, cookielength |
| (SLD : canyonrvcenter.com) |
|
| zum Seitenanfang ↑ |
| Cranes R.V. Refrigeration Inc. |
| RV refrigerators - Dometic and Norcold refrigerators |
| http://www.gasrefrigeration.net/ |
| Located in Vallejo. Provides sales and service for gas and propane refrigerators and cooling units. Also has used parts for sale. |
| Sells rebuilt, gas, RV and cabin refrigerators, and hard-to-get Dometic, Norcold and Sibir RV refrig erator parts. Located in Vallejo |
| RV refrigerators, refrigerator parts |
| refrigerators, california, refrigerators, cooling, norcold, dometic, refrigeration, cranes, refriger ator, vallejo, rebuilt, within, please, rebuilt, information, directions, cooling, trailer, customer s, unless, product, copyright, specialty, section, cranesrv, contact, details, search, inquiries, di stance, general, otherwise, dealers, travel, service, manuals, warranty, rebuilds, dealers, please, looking, repairs, diagnosis, shipped, freeze, crystal, refrigerator, rebuild, servel, refrigerator, others |
gasrefrigeration.net - rank der domain 987801 (16674 in CA)
|
|
| zum Seitenanfang ↑ |
| Simi RV Sales and Service |
| RVs for Sale in Simi Valley, CA - Fifth Wheels, Diesel Pusher, Travel Trailers, Toy Haulers, Class A and Class C Motorhomes | Simi RV |
| http://www.simi-rv.com/ |
| Located in Simi Valley. Offers motorhomes, travel trailers, fifth wheels, and toy haulers. Also sell s used motorhomes and offers parts and service. |
| Simi RV is an RV dealer located in Simi Valley, California. We have new and used RVs from Dutchmen, Eclipse, Forest River, Four Winds, Holiday Rambler, Keystone and Monaco. We offer the best prices and the best customer service. |
| Simi RV, Dealer, Recreational Vehicles, Dealership, Dealers, California, CA, Simi Valley, Los Angele s, Ventura, Motorhomes, Motor Home, Travel Trailers, Fifth Wheels, 5th Wheels, Toy Haulers, Diesel P usher, Gas, Sales, Service, Class A, Monaco, Holiday Rambler, Savoy, Pegasus, Prowler, Pull Trailers , Safari, Next Level, Gear Box, Used. |
| images, document, dealersite, repeating, psndealer, slideshow, preload, blendtrans, scrollmsg, slide showspeed, length, background, center, repeat, settimeout, dealer, inventory, footer, service, subst ring, welcome, filter, duration, filters, function, runslideshow, visistat, window, crossfadeduratio n, catalog, location, protocol, dealership, adding, contact, directions, request, coupons, continue, models, manufactuer, showroom, services, specials, internet, pcheck, prices, unbeatable, lifestyle, service, highest |
| (SLD : simi-rv.com) |
|
| zum Seitenanfang ↑ |
| Hansel RV Center |
| Smart Web Concepts |
| http://www.hanselrv.com/ |
| New and used Class A and Class C motorhomes, diesel pushers, fifth wheels, and travel trailers. Also offers parts and service. Located in Petaluma. |
| |
| |
| concepts |
| (SLD : hanselrv.com) |
|
| zum Seitenanfang ↑ |
| Metro RV |
| Los Angeles, CA RV Sales: New, Used, Rentals, Fifth Wheels, Toy Haulers, Motorhomes |
| http://www.metrorv.com/ |
| Offers sales, service, parts, accessories, and rentals. Includes description of inventory, list of s ervices, and rental rates. Locations in Santa Ana and Burbank. |
| Metro RV is your Southern California dealer for new and used motorhomes, fifth wheels, and toy haule rs. In addition to RV sales, we also offer motorhome rentals, a large parts inventory, and service. Our Burbank location is convenient for most of Southern California. |
| Metro RV, RV, Burbank, California, CA, Dealership, Dealer, North Hollywood, Hollywood,Valencia, Pasa dena, Los Angeles, Anaheim, Santa Clarita, Recreational Vehicles, Gulf Stream, Thor, Forest River, C ardinal, RVs, New, Used, Motorhomes, Fifth Wheels, Toy Haulers, Service, Parts, Rentals,Fleetwood, T railblazer, Travel Trailers |
| border, styles, menuanchorbox, background, menucontainer, onload, document, menuanchorleft, menuanch ortop, service, padding, decoration, function, window, family, visistat, powersportsnetwork, contain er, burbank, verdana, 020866, active, weight, summer, bassett, getelementbyid, ginger, rentals, rece ive, inventory, request, reservation, savings, booking, special, mytextcolor, domainid, holder, play flashscriptaccess, dealercode, accessories, loading, pricing, featinv, typeof, inventoryscroller, pl ayer, mention, privacy, mention, ginger |
metrorv.com - rank der domain 918436 (397570 in US)
|
|
| zum Seitenanfang ↑ |
| RV Outlet, Inc. |
| RV Outlet. A Fresno RV Inc. Company - 5th Wheels, Travel Trailers, Class A Motorhomes, Class C Motorhomes, Toy Haulers, Diesels, Park Homes |
| http://www.rvoutlet.net/ |
| Located in Fresno. Offers sales and service. |
| Description Here1 |
| Keywords Here |
| motorhomes, haulers, diesels, trailers, wheels, travel, refinance, service, contact, warranty, clear ance, fresno, company, outlet, inventory, qualify |
| (SLD : rvoutlet.net) |
|
| zum Seitenanfang ↑ |
| Pan Pacific RV |
| Stockton & Sacramento - Pan Pacific RV Centers, Inc. - Start Page |
| http://www.panpacificrvs.com/ |
| Locations in French Camp, Roseville, and Sacramento. Sells new and used motor homes, trailers, fifth theels, and toy haulers. Also offers service and parts. |
| Pan Pacific RV Centers, Inc. sells motorhomes, tent trailers, fifth wheels, luxury motor homes, and pull trailers. |
| winnebago, california, bay area, tent, trailer, rv, camping, fifth-wheel, stockton, sacramento, nort hern california, roseville |
| trailer, pacific, haulers, se7ucy, heartland, keystone, centers, showroom, french, indoor, service, trailers, specials, keystone, montana, winnebago, lightweight, sacramento, document, se7ucys, locati on, winnebago, internet, financing, subject, everything, morgan, roseville, deposit, received, malla rd, california, northern, newest, service, contact, company, statement, vehicles, controlled, sunnyb rook, climate, hauler, online, customer, fountain, complete, inventory, center, latest, recreational |
panpacificrvs.com - rank der domain 966316 (392005 in US)
|
|
| zum Seitenanfang ↑ |
|
