|
| Banner Design - Animated Web Banner Maker - Banner ad Design |
| http://www.bannersmall.com |
| Animated Banner design company -Making banners from 2003- 75000 banners and 6000 clients |
| Professional Banner Design Service - Animated, Static web Banner,High end design,24 hour turnaround - Making Banners since 2003 |
| animated banners,banner maker,animation banner,html banner,banner templates,animated gif banner,web banners,banner design,ad banner design,banner ad design,create banner,web banners,banner ad,banner c reation,banner designers,advertising design firm,creative ads,internet banners,animated banners,bann er creation services |
| decoration, margin, family, height, banner, 2b2b2b, design, weight, 344e7a, animated, active, questi ons, fontb2, visited, e4e4e4, bottom |
bannersmall.com - rank der domain 238274 (94240 in US)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Banner Design Firm |
| We design unique banner ads from just .95 - BannersMall.com |
| http://bannersmall.com/ |
| Custom animated banners and ad design with a 48-hour delivery. |
| affordable pricing, professional quality, and a swift delivery service. |
| animated banners,banner maker,animation banner,html banner,banner templates,animated gif banner,web banners,banner design,ad banner design,banner ad design,create banner,web banners,banner ad,banner c reation,banner designers,advertising design firm,creative ads,internet banners,animated banners,bann er creation services |
| margin, family, decoration, height, 2b2b2b, dc2611, weight, bottom, questions, design, bannersmall, e4e4e4, fontb2, visited, banner, unique |
bannersmall.com - rank der domain 238274 (94240 in US)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Banner |
|
|
| Banner |
| zum Seitenanfang ↑ |
| Hey Banner, Banner |
| Web banner ad design |
| http://heybannerbanner.com/ |
| Animated banner ad design featuring award-winning designers and copywriters. Fast turnaround. |
| The Banner Guy, who designs nothing but banner ads Banner ad designer banner design web banner flash |
| banner ads, banner ad design, ad banners, web banner, baner, designer, internet banner, banner, desi gn, banner design, ads, flash |
| length, banner, folders, client, banner, 728x90, designed, design, banners, banners, random, parsein t, another, document, within, samples, iphone, request, online, animated, target, campaign, started, heybannerbanner, custom, marketing, paypal, advertising, change, reload, standard, skylight, dollar s, available, recent, button, trackable, designers, highly, discuss, specifications, requirements, m atter, formats, winner, tastefully, created, outside, advance, policy, testimonials |
heybannerbanner.com - rank der domain 301524 (115428 in US)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Media 2.0 |
| Web banner ad design |
| http://www.2pt0.com/ |
| Optimizes web sites for search engines and web directories. |
| The Banner Guy, who designs nothing but banner ads Banner ad designer banner design web banner flash |
| banner ads, banner ad design, ad banners, web banner, baner, designer, internet banner, banner, desi gn, banner design, ads, flash |
| length, banner, folders, client, banner, 728x90, designed, design, banners, banners, random, parsein t, another, document, within, samples, iphone, request, online, animated, target, campaign, started, heybannerbanner, custom, marketing, paypal, advertising, change, reload, standard, skylight, dollar s, available, recent, button, trackable, designers, highly, discuss, specifications, requirements, m atter, formats, winner, tastefully, created, outside, advance, policy, testimonials |
| (SLD : 2pt0.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Search_Engine_Optimization_Firms/M |
| zum Seitenanfang ↑ |
| Banner |
|
|
| Banner |
| zum Seitenanfang ↑ |
| Web Banner Design |
| Web Banner Design, Web Banners Design, and Web Banner Advertising Design by Strategic Solutions: Web Banner |
| http://www.ss-banners.com/ |
| Custom design advertising banners, static, animated, or interactive. Examples provided. |
| Web banner design, web banners design, and web banner advertising design by Strategic Solutions, pro fessional web banner design business offering banner ad design, web banner design, banner advertisin g design, website banner design, favicon design, and favicons design services. |
| web banner design, web banners design, web banner advertising design, web banner, web banners, web b anner advertising, banner design, banners design, banner advertising design, banner advertising, ban ner, banners, banner ad, banner ads, custom banners, online banner, website banner, page banner, web banners, animated banner, flash banner, banner designs, website banners, online banners, web site b anner, advertising banners, animated banners, ad banners, banner ad design, internet banner advertis ing, banner graphics, banner creation, banner designer, banners ads, advertising banner ads, adverti sement banner, web page banner, banner advertisement, online banner advertising, flash banner ad, di gital banners, make web banner, web banner ads, banner advertise, internet banner ads, web site bann er advertising, banners gif, flash banner design, flash banner ads, flash web banner, web banner ad, web page banners, banner ad advertising, website banner advertising, 468x60 banner, banner designin g, banners designs, onli |
| design, design, banner, banner, banners, strategic, solutions, runcontent, gajshost, selectednode, d ocument, attract, consulting, offers, hosting, services, services, header, advertising, pagetracker, quality, 10612387, registration, domain, customized, development, gettracker, addition, similar, so ftware, making, attractive, trackpageview, elegant, unique, always, search, engine, business, profes sional, analytics, offering, 3cscript, unescape, google, favicons, website, favicon, sitemap, protoc ol, programming |
| (SLD : ss-banners.com) |
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Bannerset.it |
| Bannerset.it - Tutto sui banner. Dimensioni standard dei banner, circuiti di scambio banner, creazione banner on line gratis. |
| http://www.bannerset.it/ |
| Presenta sezioni dedicate ai banner, con informazioni sulle dimensioni standard, sulla loro utilità e un tool per crearli online. |
| Servizi relativi alla creazione di banner pubblicitari, circuiti di scambio banner, creazione di ban ner on line. |
| banner, creazione banner, creazione banner on line, tutto gratis banner, banner gratis, scambio bann er, circuiti banner, circuiti di scambio banner, dimensioni standard banner, standard iab, banner st andard |
| banner, banner, scambio, gratis, circuiti, creazione, dimensioni, standard, benvenuti, glossario, cr eazione, scambio, questo, bannerset, bottoni, bannerset, dimensioni, standard |
bannerset.it - rank der domain 966211 (17974 in IT)
|
| World/Italiano/Computer/Grafica |
| zum Seitenanfang ↑ |
| Banner-Exchange |
| Banner-Exchange.ORG |
| http://banner-exchange.org/ |
| Basic banner exchange. [Ratio: 3:2 Banner Sizes: 468x60] |
| |
| |
| exchange, banner, banner, credits, earning, displayed, displaying, credit, accumulated, another, mem bers, 2956248, reserved, banners, served, rights, traffic, copyright, directory, resources, exchange , design, groups, related, design, websites, discussion, signup, username, password, through |
| (SLD : banner-exchange.org) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Banner 4 U |
| Banner4U.net! Banner Creation Services = Effective Banner Ad Designs |
| http://www.banner4u.net/ |
| Free banner creation service offers animated and 3D lettering in exchange for link back to site. |
| Banner ad design. Custom designed banner ads. Affordable, quick turnaround, great services |
| banner,banner creation,creating banners,banner creator,banner designer,banner designs,banner ad desi gn, banner ad designer, making banners,banners,custom banner designer,buttons created,button creator ,flash,animation,Banner,Banners,flash banner designer,animated banners |
| banner, banner, advertising, banner4u, bannerdesigner, creating, campaign, discounts, copyright, int ernet, creation, designs, specializes, effective, creation, services, custom, banner4u, design |
| (SLD : banner4u.net) |
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| The Gospel Banner Exchange |
| Banner Exchange |
| http://exchange.christiansunite.com/ |
| 2:1 ratio. Banner size: 468x60. You must adhere to their specified Christian creed. Exchange attache s their ad. |
| Free Christian Banner Exchange. Display your site's banner on other Christian Web sites across the i nternet. |
| Free, banner,banner exchange,advertising,christian, search engine, directory, religion, resources, f amily, God, bible |
| 000099, normal, banner, exchange, visited, exchangemain, 990000, helvetica, family, weight |
christiansunite.com - rank der domain 101681 (41342 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest/Christian |
| zum Seitenanfang ↑ |
| QuickBanner |
| QuickBanner - Online flash banner maker and animated banner design. |
| http://www.quickbanner.com/ |
| Online banner maker enables you to create, design and animate customized banners in three steps. |
| Online banner maker enables you to create, design and animate customized flash banners in three simp le steps. |
| banner maker, banner design, animated banner, flash banner, banner creator, create banner, banner s oftware, make banner, banner creation, making banner, banner generator, banner ad creation, banner d esigner, flash banner design, banner making, banner ad maker, flash banner ads, flash banner maker, flash banner generator, flash banner template, make flash banner, banner exchange, banner advertis ing, banner, flash, online, QuickBanner, www.quickbanner.com |
| family, verdana, decoration, document, banner, cookie, 000000, ffffff, underline, 333366, template, loginform, margin, return, templates, function, browse, length, createbanner, password, languagebar, navbar, window, endstr, quickbanner, active, visited, ffcc00, findoutmoretext, domain, expires, pad ding, member, banner, secure, offset, creator, 468x60, animated, bottom, select, choose, design, req uired, openwindow, setcookie, banners, leading, getcookieval, create, substring |
quickbanner.com - rank der domain 360071 (140277 in US)
|
| Computers/Internet/Web_Design_and_Development/Authoring/Online_Tools/Graphics/Image_Generation |
| zum Seitenanfang ↑ |
| Banner promotion |
| SCAMBIO BANNER GRATUITO PROFESSIONALE |
| http://www.bannerpromotion.it/ |
| Rapporto di esposizioni 3:2, 500 crediti omaggio all'iscrizione, possibilità di scegliere le categor ie di siti su cui visualizzare il banner, e quelle da cui accettare banner, possibilità di esporre p iù banner nelle proprie pagine. |
| |
| |
| professionale, gratuito, banner, scambio |
bannerpromotion.it - rank der domain 945623 (16868 in IT)
|
| World/Italiano/Computer/Internet/Marketing/Scambio_Banner |
| zum Seitenanfang ↑ |
| Travel Banner Exchange |
| Travel Banner Exchange : Free travel banner exchange from ClickLeisure.com |
| http://www.clickleisure.com/ |
| Banner exchange reserved exclusively for travel related websites. [Ratio: 2:1 Banner Sizes: 468x60] |
| Travel banner exchange. We offer a free travel banner exchange for owners of all travel sites. Our m embers enjoy huge traffic boosts, along with bonus credits and unlimited search engine submission. J oin Today! |
| travel banner exchange, travel banner xchange, free travel banner exchange, travel site promotion, t ravel site advertising |
| banner, statement, privacy, resources, exchange, travel, clickleisure, contact, information, classif ieds, submission, further, advertise, neobanners, promote, tuesday, travel, banner, exchange, accoun t, generator, address, password |
clickleisure.com - rank der domain 869541 (0 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest |
| zum Seitenanfang ↑ |
| Greater Banner Elk Business Association |
| Banner Elk |
| http://www.bannerelk.org/ |
| Area accommodations, restaurants, shops, services, and real estate. Includes organization minutes, e vent notices, and live camera. |
| Banner Elk Chamber of Commerce features Banner Elk North Carolina, Banner Elk Sugar Mountain, Banner Elk NC real estate, Banner Elk real estate. |
| banner elk chamber of commerce, banner elk, banner elk north carolina, banner elk sugar mountain, ba nner elk nc real estate, banner elk real estate, banner elk nc hotel, banner elk cabin rental, banne r elk nc vacation, banner elk accommodation, banner elk web cam, banner elk nc extended weather fore cast, banner elk nc map, nc wedding, nc mountain wedding |
| banner, chamber, runcontent, beautiful, offers, restaurant, mountains, runactivecontent, summer, eve nts, macromedia, native, flowers, biking, hiking, trails, friendly, located, village, better, welcom es, because, environment, restaurants, moment, arrive, spring, welcome, people, guests, campus, coll ege, family, entire, picnic, relaxing, settings, natural, nature, ponder, numerous, dinner, country, attractions, something, accommodations, chamber, service, courses, business, offering |
| (SLD : bannerelk.org) |
| Regional/North_America/United_States/North_Carolina/Localities/B/Banner_Elk/Business_and_Economy |
| zum Seitenanfang ↑ |
| Banner 30 |
| Banner 30 klubben, velkommen |
| http://www.banner-30.dk/ |
| Banner 30 klubben. Specialklub under Dansk Sejlunion, for bådtypen Banner 30. |
| |
| |
| normal, weight, family, padding, border, decoration, bottom, height, spacing, helvetica, tahoma, ver dana, indent, cursor, 333333, helvetica, important, nowrap, letter, injection, klubben, underline, v elkommen, repeat, margin, background, banner |
| (SLD : banner-30.dk) |
| World/Dansk/Fritid/Sejlads/Klasser |
| zum Seitenanfang ↑ |
| Impronta dell'Orso |
| i banner |
| http://www.improntadellorso.it/banner.html |
| Analisi su come impostare e ottimizzare campagne banner online. |
| analisi sull'efficacia dei banner pubblicitari nell'ambito dell'online advertising |
| |
| banner |
| (SLD : improntadellorso.it) |
| World/Italiano/Affari/Marketing_e_Pubblicità/Pubblicità/Agenzie |
| zum Seitenanfang ↑ |
| 1ha |
| 1ha banner network |
| http://1ha.ad.md/ |
| Молдавская баннерная сеть. Формат 100х100, комиссия 10%, подъемные 1000. |
| The 1ha banner network includes a banner exchange and offers commercial advertising services |
| 1ha banner network hectar advertising Moldova DNT design.md |
| network, banner |
| (SLD : ad.md) |
| World/Russian/Компьютеры/Интернет/Дизайн_и_разработка_сайтов/Продвижение_сайтов/Баннерные_сети/Региональные |
| zum Seitenanfang ↑ |
| HitExchange |
| HitExchange - Banner Exchange Network |
| http://www.hitx.net/ |
| Trade banner click-throughs. Supports up to eight banners per account. [Ratio: 4:5 Banner Sizes: 468 x60, 400x50, 400x40] |
| In this banner exchange, web sites trade click-thrus at 5:4 ratio or better. And unlike other banne r exchanges, our members display banners only for fellow members. |
| banners, banner advertising, free banners, banner exchange, free banner exchange program, web advert ising, web promotion, banner ad, link exchanges, good banner exchange, click through, click thru |
| password, hitexchange, visitors, receive, participate, welcome, account, network, banner, exchange, operate, exchange, banner, advertise |
hitx.net - rank der domain 973508 (422744 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Banner Ignition |
| Banner Ignition - Making Banner Management Easy |
| http://www.bannerignition.co.za |
| Offering banner creation and banner campaign management. |
| Banner Ignition - Making Banner Management Easy |
| |
| website, banner, ignition, income, traffic, banner, market, making, additional, banners, advertise, listed, clicks, results, specific, measurable, existing, advertising, becoming, websites, assists, c onversions, visits, through, indicators, everything, heavenly, budget, require, quantify, success, e nabling, depend, current, invoices, prices, advertisers, statistics, loaded, generated, easily, sche duled, uploaded, giving, identify, shapes, clients, compliant, effort, nearly, through |
co.za - rank der domain 11218 (28 in ZA)
|
| Business/Marketing_and_Advertising/Internet_Marketing/Marketing_Services |
| zum Seitenanfang ↑ |
| Banner Italia |
| Banner Italia |
| http://www.banneritalia.altervista.org |
| Scambio banner con rapporto di scambio 1:1 |
| Banner Italia è un sistema di scambio banner molto professionale con il quale pianificare le tue cam pagne pubblicitarie, offre gratuitamente statistiche dettagliate, un rapporto di visualizzazione van taggiosissimo,possibilità di inserire uno o più banner nel sistema, i siti iscritti hanno tutti un u nico scambiobanner che aumenta notevolmente il CTR. |
| |
| banner, modifica, dimensione, copyright, 60pxformato, registrazione, domini, redirect, creazione, ri ghts, reserved, banner, preleva, codice, aggiungi, registrati, italia, questo, scambio, rapporto, se rvizio, gratuito |
altervista.org - rank der domain 550 (9 in IT)
|
| World/Italiano/Computer/Internet/Marketing/Scambio_Banner |
| zum Seitenanfang ↑ |
| Adendum |
| Banner Exchange and internet banner ad exchange. |
| http://adendum.com/ |
| Can have up to four banners and multiple URLs for each banner. [Ratio: 3:2 Banner Sizes: 468x60] |
| Banner Exchange and internet banner ad exchange, learn how to use it. |
| banner exchange,advertising. |
| banner, banner, exchange, advertising, exchange, banners, credits, displayed, design, online, promot ion, advertising, towards, 468x60, networks, adendum, several, diagram, customers, people, detailed, choose, document, creative, become, resources, different, placement, prefer, others, combined, feat ures, directed, familiar, allows, advertise, identification, awareness, system, section, effective, design, promotional, effort, testing, facility, copyright, rather, target, information, account |
adendum.com - rank der domain 977889 (423700 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Softbiz Banner Ads Management Script |
| BANNER ADS MANAGEMENT SCRIPT : Manage Banner Ads automatically. PHP MySQL Script |
| http://www.softbizscripts.com/banner-ads-management-script-features.php |
| Run banner ads on site with this PHP script. Advertisors buy banner impressions via paypal. |
| Softbiz Banner Ad Management Script automates the advertising interface of your site and 100% optimi zes its earning potential. Saves you time,effort. |
| Banner, Ad, Ads, Banner Ad Management, Script, PHP, Banner Management, PHP, MySQL, Script |
| script, script, software, banners, directory, language, banner, banner, advertisers, management, scr ipts, classifieds, through, impressions, exchange, different, display, article, auction, advertising , configure, unapproved, provide, schemes, domain, feature, extensive, delete, approved, native, gal lery, advertiser, scheme, shopping, dating, online, experience, change, parameters, administrator, c olors, settings, service, received, length, clicks, translate, strings, displayed, particular, featu res |
softbizscripts.com - rank der domain 46290 (2097 in IN)
|
| Computers/Programming/Languages/PHP/Scripts/Ad_Management |
| zum Seitenanfang ↑ |
| MessiahNet Banner Exchange |
| MessiahNet Banner Exchange |
| http://banners.messiahnet.com/banner_info.htm |
| 1:1 ratio plus 1000 credits. Banner size: 400x40. Exchange attaches their ad, to the left of your ba nner, and a text link below. For Messianic and Christian ministries who support and encourage Jewish believers in the Messiah. Must adhere to a statement of faith. |
| |
| |
| exchange, banner, messiahnet |
| (SLD : messiahnet.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest/Christian |
| zum Seitenanfang ↑ |
| Cordelia Loew - Banner und Fahnen |
| |
| http://www.loewe-banner.de/ |
| "Loewe Banner Kreativwerkstatt zur Ehre Gottes" fertigt Banner, Flaggen und Fahnen. |
| |
| |
| klicken, sollte, weiterleitung, funktionieren |
| (SLD : loewe-banner.de) |
| World/Deutsch/Online-Shops/Religion_und_Spiritualität/Christentum |
| zum Seitenanfang ↑ |
| Ah! Banner |
| Retractable Banner Stand | Trade Show Display | Banner Wall & Vinyl Banners |
| http://www.ahbanner.com/ |
| Manufactures banner stand displays for trade shows, exhibitions, point of sale, shop windows, produc t promotions, and other display purposes. |
| Ahbanner specializes in retractable banner stands and trade show display including top quality vinyl banners, roll up, pull up banner, floor graphics, outdoor banner stands & more. |
| retractable banner stands, trade show display, banner stand, vinyl banners, outdoor banner, advertis ing banners, banner shop, x banner stands, retractable banner, trade show banner, vinyl signage, dis play banners, banner wall, floor graphics, retractable banner stand, banner stand retractable, promo tion table, banner stand display, vinyl banner printing, custom vinyl banners, pull up banners, reta il banner stands, portable banner stands, floor decals, outdoor banner stands, roll up banner stands , trade show display stands, portable banner stand, tradeshow banners, trade show display graphics, retractable banner displays, tradeshow banner stand, replacement banner, banner stand graphics, qual ity banner stands |
| banner, banner, retractable, promotion, graphics, banners, display, replacement, copyright, bestsell ers, reception, showcase, search, shopping, windows, wedding, decoration, exhibition, seminar |
| (SLD : ahbanner.com) |
| Business/Business_Services/Event_Planning_and_Production/Convention_and_Trade_Show_Services/Exhibit_and_Display_Vendors/Portable_and_Modular_Displays/Manufacturers |
| zum Seitenanfang ↑ |
| 20 Dollar Banner Design |
| Banner Design from , Web Banner, Flash Banner, Animated Banner |
| http://www.20dollarbanners.com/ |
| Offers static or animated banner design. |
| Professional Web Banner Design Service from only - with premium 24 hour turn-around time service . |
| banner design,website design,web banners,banner ad,banner designers, advertising design firm,creativ e ads,free banners,animated banners,banner creation services |
| banner, banners, portfolio, clients, function, designed, hosting, design, clients, design, recently, recent, recent, partners, banner, contact, 20dollarbanners, turnaround, professional, affiliates, r eserved, armand, package, 20dollarbanners, offers, increase, machetes, customer, urchintracker, moto va, hostican, password, servers50, recommended, 3132932, online, hostingdedicated, marketplace, forg otten, password, advertising, ecoverart, program, reseller, tutorials, reviews, copyright, condition s, akmodalremove, clientsbelow, closeoptin |
20dollarbanners.com - rank der domain 76759 (28363 in US)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| NeedBanner |
| NeedBanner - We design custom banner ads |
| http://www.needbanner.com/ |
| Custom animated and flash banner ads. Browse portfolio for banner advertising examples. |
| Professional custom banner ad design. Our graphic designers will create your gif or flash banners ad , static or animated banner advertising. |
| banner design, banner maker, banner creation, banner ads, flash banner, banners ad, banner advertisi ng |
| document, window, onerror, banner, custom, lasterrorhandler, referrer, firetoolbar, function, noacce sserrorhandler, referrerurl, escape, dhtmlloadscript, navigator, guarantee, experience, banners, des igned, needbanner, needbanner, design, forcerefresh, touppercase, server, secondsbeforeclose, availa ble, secondsbeforeshow, maximum, secondsbeforefireagain, toolbar, webtoolbars, launcher, getseconds, refresh, appversion, parsefloat, script, createelement, javascript, getelementsbytagname, useragent , indexof, appendchild, secure, return, quality, benefit, impressions, clients, satisfaction, profes sional |
| (SLD : needbanner.com) |
| Computers/Graphics/Web/Banners/Flash |
| zum Seitenanfang ↑ |
| Banner |
| - Banner.Sahil.Az - |
| http://banner.sahil.az |
| Şirkət və internet reklam xidmətləri haqqında məlumat. |
| |
| |
| createelement, document, background, repeat, tahoma, 3e3a3f, border, helvetica, verdana, decoration, fbfbfb, family, 1744638, urchintracker, banner, 444d52, frmtext, 333333, textarea, banner, necheye2 , neuchun2, necur2, window, onload, select, function, position, center, nedir2, harda2 |
sahil.az - rank der domain 995263 (442 in AZ)
|
| World/Azerbaijani/Biznes/Reklam_və_Marketinq |
| zum Seitenanfang ↑ |
| Everypoet Exchange |
| POETRY BANNER EXCHANGE! Join Everypoet Banner Exchange, the best banner exchange program for arts and literature sites |
| http://www.everypoet.com/exchange/promotion.htm |
| A free banner exchange network for arts and literature sites, particularly those concerned with poet ry and writing. [Ratio: 3:2 Banner Sizes: 468x60] |
| Everypoet Exchange - the free banner exchange program for poetry, arts and literature sites. |
| banner exchange,banner network,poetry banners,poetry banner exchange,literature,literary,poetry bann er network,writing,art,dance,drama,theater,theatre,advertising network,banner ads,ad network,literar y banner exchange,literary banner network,zine,ezine,e-zine,ezines,music banner exchange,ad exchange ,link exchange,website banner exchange,banner swap,ad swap,poetry ad network,BANNER EXCHANGE |
| exchange, everypoet, banner, poetry, exchange, network, fastclick, literature, banner, program, acce pted, banner, outsourced, information, poetry, exchange, exposure, serving, qualify, everypoet, serv ice, extremely, recommend, reliability, service, provided, highly, quality, impressions, archive, ab surdities, newsletter, showcase, lounge, search, selendy, communications, advertise, everypoet, hsad visor, please, upgrade, undergoing, extensive, augustcutter, umbrellazine, comfusion, little, review , adirondack, sampling |
everypoet.com - rank der domain 642502 (278120 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest |
| zum Seitenanfang ↑ |
| Banner Exchange Program |
| Banner Exchange Program - Free Banner Advertising Network By Bpath |
| http://www.bpath.com/bannerexchange/ |
| Allows resale of exchange credits. [Ratio: 2:1 Banner Sizes: 468x60] |
| Free Banner exchange program allows you to exchange, trade and advertise your banners, increasing yo ur web site traffic for free. |
| banner exchange, banner exchange program, free banner exchange, exchange banner, banner program, exc hanging banners, banner rotation, banner trade, banner ad, exchange traffic, link exchange, button e xchange, free banner, banner advertising, free banner advertising, banner impression, free advertisi ng, internet advertising, online advertising, increase web site traffic, increase traffic, web site advertising, web advertising, promotional advertising, free internet advertising |
| normal, family, verdana, decoration, weight, service, 003366, selected, banner, loginform, document, active, password, visited, f2f2f2, banner, credits, online, program, visitors, exchange, return, me mber, exchange, advertising, length, getting, millions, network, signing, required, select, function , website, creator, 2117358, audience, success, target, company, problem, traffic, urchintracker, di splay, background, personal, 71828a, displayed, example, international, program |
bpath.com - rank der domain 11852 (160 in IT)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Half Price Banners . com |
| Half Price Banners |
| http://www.halfpricebanners.com/ |
| Custom Vinyl Banners at reduced prices for most applications. |
| Banners: Custom vinyl banners! Custom vinyl signs and banner, vinyl banner, Fast signs and banner. |
| Vinyl Banner,banners,signs,custom vinyl banner,Vinyl sign banners,custom banners,vinyl banner,banner vinyl,vinyl church banner, church banners,sports banner,custom banner, banners,banner,sign banner, fast signs,fast banners |
| premium, document, clipartwindow, clipart, function, design, getelementbyid, openclipartwindow, wind ow, height, resizable, status, scrollbars, clipart1, stylesheet, screen, projection, safari, clipart img1name, clipartimg2, clipartimg1, clipartimg2name, example, question, images, ignoring, resetclipa rt, style1, script, bookmark, setclipart, digits, useragent, navigator, remaining, firefox, startpag eload, banners |
halfpricebanners.com - rank der domain 531726 (199563 in US)
|
| Business/Business_Services/Signage/Vinyl/Online_Sales |
| zum Seitenanfang ↑ |
| Bannerdesign.eu |
| Banner design studio. Banner ontwerp door bannerdesigner |
| http://www.bannerdesign.eu |
| Een banner design studio die zich bezighoudt met het ontwerpen van banners en landingpages. |
| Bannerdesigner is een professionele banner design studio. Wij ontwerpen uitdagende, effectieve banne rs en bannersets gericht op conversie. Bannerdesign en banner ontwerp in alle gewenste formaten. |
| bannerdesign, banner design, banner ontwerp, banner, banners, banner maken, bannerdesigner, ontwerpe n banners, bannerdesign studio, bannerset |
| banner, bannerdesigner, studio, design, ontwerp |
| (SLD : bannerdesign.eu) |
| World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners |
| zum Seitenanfang ↑ |
| ReaLook Banner Exchange |
| ReaLook: Banner Exchange Program |
| http://www.realook.com/bannerexchange.html |
| Basic banner exchange. [Ratio: 2:1 Banner Sizes: 468x60] |
| ReaLook: Banner Exchange Program. Join today, it's free! |
| banner exchange, banner, promote your site |
| banner, realook, banner, program, exchange, exchange, members, website, information, websites, servi ce, membership, cancel, credit, account, without, provided, member, display, reserves, banners, guar antee, 468x60, groups, agrees, contain, permission, remove, automatically, appropriate, through, dis cretion, modify, notice, advertiser, reject, deleted, inactivity, questions, contact, signup, cancel lation, violation, result, inactive, members, urchintracker, statistics, caused, responsible, uptime |
realook.com - rank der domain 927005 (395656 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| natban.com |
| National Banner Sewing |
| http://natban.com/ |
| USA. Custom sewing and finishing of banners and signage. Also, radio frequency welding services. |
| Natban was established in 1995 and has been dedicated in providing outstanding quality to our client s ever since. Our specialty is in the area is vinyl banner "finishing." |
| banners,vinyl banners,custom banners,banner sewing,custom vinyl banners,signs and banners,sign banne rs,banner signs,blank banners,sewing banners, finishing banners, banner finishing, banner grommets, banners with grommets, hemmed banners, banner hem, pole pockets, banner pole pockets,banner sewing s ervice, banner service, banner finishing service,heat seal,heat seal banners,rf welding,radio freque ncy welding,banner welding,banner seal,banner heat seal,banner hemming,hemming banners,banner webbin g,banner preparation,banner outsourcing,sewing outsourcing,banner sewing outsourcing,low cost banner sewing,low cost sewing,sewing for banners, heat seaming,banner heat seaming,sewing digital banners, digital banner sewing,banner sewing business,sewing banner service,banner sewing service,sewing bann ers business,national banner,national banner sewing,natban,natban sewing,national banner supply,viny l signs,vinyl indus |
| margin, wrapper, vertical, center, middle, skiplink, border, sewing, banner, national, padding, heig ht |
| (SLD : natban.com) |
| Business/Textiles_and_Nonwovens/Textiles/Contractors |
| zum Seitenanfang ↑ |
| Banner Listesi |
| |
| http://www.bannerlistesi.com |
| Ücretsiz ve ücretli olarak banner değişim sistemi. |
| |
| |
| banner |
bannerlistesi.com - rank der domain 986850 (0 in US)
|
| World/Türkçe/Bilgisayar/İnternet/Web_Tasarımı_ve_Geliştirme/Tanıtım/Reklam_Değişimi |
| zum Seitenanfang ↑ |
| FreeVisits.de |
| FreeVisits.de - Banner-Werbung kostenlos als Banner-Tausch |
| http://www.freevisits.de/ |
| Ein kombinierter Banner-, PopUp- und Textlink-Tausch mit einer großen Vielfalt an Werbeformen. |
| FreeVisits.de - Banner-Werbung kostenlos als Banner-Tausch |
| Banner,Tausch,Exchange,kostenlos,Werbung,Webmaster |
| banner, tausch, qualit, mitfairer, freevisits, werbung, kostenlos, kostenloser |
| (SLD : freevisits.de) |
| World/Deutsch/Computer/Internet/Webdesign_und_-entwicklung/Promotion/Tauschdienste |
| zum Seitenanfang ↑ |
| NL Banner |
| NL Banner exchange wij brengen je gratis de bezoekers |
| http://www.nlbanner.nl/ |
| Richt zich volledig op de Nederlandse markt, ratio 2:1. |
| NL banner de beste gratis banner exchange voor nederland |
| banners,reclame,gratis,nederland,bezoekers,exchange,websites |
| banner, browser, bekijkenup, frames, bezoekers, exchange, banner, brengen, gratis |
| (SLD : nlbanner.nl) |
| World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Ribbon Generator |
| Diagonal Advertising Banner Design | Free Corner Web Banner Ads |
| http://www.websiteribbon.com |
| Provides a ribbon generator to copy and paste on a website. |
| Free advertising banner web design tool to make on websites a corner diagonal banner ad containing a message and optional link. |
| diagonal banner, web banner, advertising banner, ad banner, web design, webmaster tool, website ribb on, corner message, banner creator |
| banner, design, banner, diagonal, tahoma, advertising, verdana, diagonal, website, advertising, opti onal, software, corner, aliceblueantiquewhiteaquaaquamarineazurebeigebisqueblackblanchedalmondbluebl uevioletbrownburlywoodcadetbluechartreusechocolatecoralcornflowerbluecornsilkcrimsoncyandarkbluedark cyandarkgoldenroddarkgraydarkgreendarkkhakidarkmagentadarkolivegreendarkorangedarkorchiddarkreddarks almondarkseagreendarkslatebluedarkslategraydarkturquoisedarkvioletdeeppinkdeepskybluedimgraydodgerbl uefeldsparfirebrickfloralwhiteforestgreenfuchsiagainsboroghostwhitegoldgoldenrodgraygreengreenyellow honeydewhotpinkindianredindigoivorykhakilavenderlavenderblushlawngreenlemonchiffonlightbluelightcora llightcyanlightgoldenrodyellowlightgreenlightgreylightpinklightsalmonlightseagreenlightskybluelights latebluelightslategraylightsteelbluelightyellowlimelimegreenlinenmagentamaroonmediumaquamarinemedium bluemediumorchidmediumpurplemediumseagreenmediumslatebluemediumspringgreenmediumturquoisemediumviole tredmidnightbluemintcreammistyrosemoc |
websiteribbon.com - rank der domain 914458 (362088 in US)
|
| Computers/Programming/Languages/JavaScript/Tools |
| zum Seitenanfang ↑ |
| Banner gratis |
|
| http://www.bannergratis.it/ |
| Rapporto 2:1 per visualizzazione più 5 crediti per ogni click, possibilità di avere più banner per a ccount. Supporta banner in Flash. |
| |
| |
| |
bannergratis.it - rank der domain 938130 (15913 in IT)
|
| World/Italiano/Computer/Internet/Marketing/Scambio_Banner |
| zum Seitenanfang ↑ |
| BannerETC.com |
| Vinyl Banner, Custom Banner, Grand Opening Banner, Vinyl Sign |
| http://www.banneretc.com/ |
| Vinyl business banners, LED and neon signs, designed to clients exact specifications for indoor or o utdoor use. |
| Offers Vinyl Banner, Custom Banner, and Grand Opening Banner advertising tools. Buy from the best so urce of outdoor signages. Competitive pricing, low price guarantee, and strong warranty for all prod ucts that you can expect good return on your investment. |
| vinyl banner, vinyl banner sign, outdoor vinyl banner, custom banner, custom banner sign, custom out door banner, custom vinyl banner, custom vinyl signs, grand opening banner |
| analytics, ystore, banner, ywatracker, banner, custom, window, pagetracker, document, domain, genera ted, banners, products, docgroup, project, increase, custom, gettracker, repeat, beacon, tahoma, fam ily, domains, background, docname, margin, banners, rights, banneretc, colima, gajshost, personal, p rovide, location, assistance, 3dyahoo, purchase, reserved, feedback, protocol, policy, contact, 1922 fax, privacy, useful, 3d973244098, heights, rowland, sitemapcopyright, checkout, 91748tel |
| (SLD : banneretc.com) |
| Business/Business_Services/Signage/Flags_and_Banners |
| zum Seitenanfang ↑ |
| Banner |
| The Banner Family from Merkel,Texas Page |
| http://members.tripod.com/~BradBanner/index.html |
| Brad and Barbara Jean from Merkel,Texas. Includes personal interests and information, links, and a m emorial tribute to Kathryn Banner. |
| Tribute to Kathryn Banner |
| |
| merkel, family, banner |
tripod.com - rank der domain 857 (45 in JP)
|
| Home/Family/Family_Websites/B |
| zum Seitenanfang ↑ |
| open-eye banner-generator |
| banner-generator, free online banner creator |
| http://www.banner-generator.net/ |
| Free online banner tool allows creation of image or flash banners in different sizes online. |
| |
| |
| banner, creator, online, generator |
banner-generator.net - rank der domain 105980 (5420 in DE)
|
| Computers/Internet/Web_Design_and_Development/Authoring/Online_Tools/Graphics/Image_Generation |
| zum Seitenanfang ↑ |
| Just Go There |
| Web Design, Web Banners, Web Banner Ad Design |
| http://www.justgothere.com/ |
| Offers web design, web support services, hosting, domain registration, Intranet solutions, graphic d esign, Flash, and e-commerce solutions. |
| Web Design, Web Banners, and Professional Web Banner Ad Design. The Best Prices for Web Services, We b Design, and Web Banner Ad Design. Professional Web Design, Web Banner Advertisements, and Search E ngine Optimization for your website. |
| Web Design, Web Banners, Web Banner Ad Design, web banner advertisement, Web Banner Pricing, Flash W eb Banners, Animated Web Banners, Web Banner Pricing, Web Banner Samples, Web Design Testimonials, S earch Engine Optimization, SEO Services, Free Website Submission, Google, Yahoo, Bing |
| design, banner, banners, optimization, engine, search |
justgothere.com - rank der domain 201571 (74824 in US)
|
| Computers/Internet/Web_Design_and_Development/Designers/Full_Service/J |
| zum Seitenanfang ↑ |
| Banner Exchange |
| Banner Exchange Program - Free Banner Advertising Network By Bpath |
| http://argentina.bpath.com/BannerExchange/bnr_info.dbm |
| Sistema de intercambio con opciones de pago y gratuitas. |
| Free Banner exchange program allows you to exchange, trade and advertise your banners, increasing yo ur web site traffic for free. |
| banner exchange, banner exchange program, free banner exchange, exchange banner, banner program, exc hanging banners, banner rotation, banner trade, banner ad, exchange traffic, link exchange, button e xchange, free banner, banner advertising, free banner advertising, banner impression, free advertisi ng, internet advertising, online advertising, increase web site traffic, increase traffic, web site advertising, web advertising, promotional advertising, free internet advertising |
| normal, verdana, decoration, weight, service, family, 003366, selected, banners, banner, visitantes, document, active, loginform, visited, f2f2f2, password, gratis, banner, intercambio, gratuito, retu rn, exchange, member, intercambio, programa, nuestro, promocionar, mostrado, usuario, informaci, imp resi, publicidad, focalice, audiencia, controle, exhibici, relaci, registrarse, eficiencia, millones , herramientas, gratuitas, creador, function, select, length, exhibiendo, required, avanzado, window |
bpath.com - rank der domain 11852 (160 in IT)
|
| World/Español/Computadoras/Internet/WWW/Diseño_y_desarrollo_web/Promoción_de_sitios/Intercambio_de_banners |
| zum Seitenanfang ↑ |
| Softbiz Banner Ad Exchange Script |
| BANNER EXCHANGE NETWORK SCRIPT : Banner Exchange Script. PHP MySQL Script |
| http://www.softbizscripts.com/banner-exchange-script-features.php |
| Run site to facilitate banner exchange advertising with this PHP script. |
| Softbiz Banner Exchange Network Script gives new earning opportunity + continuous Advertising + tra ffic generation mechanism to you. |
| Banner, Exchange, Network, Ads, Banner Ad Exchange, Script, Network, Banner Ads network, Ad Exchange PHP, MySQL, Script |
| script, banner, software, banners, campaigns, directory, script, impressions, exchange, language, ba nner, exchange, scripts, campaign, scheme, multiple, configure, classifieds, management, different, credits, members, article, auction, service, extensive, option, signup, members, feature, domain, me mber, between, surplus, shopping, features, dating, online, gallery, provide, native, display, schem es, detailed, clicks, multiple, manage, defined, support, campaigns, delete |
softbizscripts.com - rank der domain 46290 (2097 in IN)
|
| Computers/Programming/Languages/PHP/Scripts/Ad_Management |
| zum Seitenanfang ↑ |
| Bannerz Exchange |
| Banner Plus - Administration |
| http://bannerz.netfirms.com/ |
| Basic banner exchange. [Ratio: 3:2 Banner Sizes: 468x60] |
| |
| |
| banner, exchange, exchange, impressions, netfirms, bannerz, banner, credits, custom, contact, answer , together, members, promotion, password, animatedonline, animated, properties, signup, administrati on, hosting, domain, everyone, unbeatable, technical, support, benefits, quality |
netfirms.com - rank der domain 4025 (1525 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Sugar House Banners |
| Sugar House Banners - Vinyl Banners & Signs Since 1941 |
| http://www.sugarhousebanners.com/ |
| Vinyl banner blanks ordered online direct from the factory. |
| Banner, Banner Design By Sugarhousebanners.com |
| Banner, Banner design, banner maker, banner printing, banner stand, banner stand and sign, banner st and and displays, banner stands, banners, birthday banner, Christian banner, Christian banners, chur ch banner, church banners, custom banner, custom banners, custom vinyl banner, custom vinyl banners, digital banners, fabric banners, fast sign, full color banners, outdoor banners, outdoor banner, re tractable banner stands, sign banner, sign supply, table cover, table covers, trade show banner, tra de show banners, trade show display, trade show displays, vinyl banner, vinyl banner printing, vinyl banners, vinyl signs, sugar house banner, sugar house banners |
| document, design, banners, banner, banner, gajshost, products, quotes, printed, number, getphonenumb er, pagetracker, banners, function, window, banners7526, streetsalt, reopen, holiday, pioneer, close d, contact, gettracker, 6689940, closed, trackpageview, location, canvas, javascript, division, ofsu gar, awningand, protocol, google, 3cscript, unescape, bannersis, business, hoursmonday, friday, anal ytics, accept, script, saturday9, formatphonenumber, refreshing, graphics, stands, tradeshow, create , upload |
sugarhousebanners.com - rank der domain 885431 (376438 in US)
|
| Business/Business_Services/Signage/Vinyl |
| zum Seitenanfang ↑ |
| Yes Nexus |
| YesNexus.com - New Generation Banner Exchange |
| http://www.yesnexus.com/ |
| Advanced statistics and targeting. [Ratio: 2:1 Banner Sizes: 468x60, 120x600, 125x125] |
| Yes Nexus banner exchange offering 4:3 Ratio with lots of bonuses for members. 1500 credits on signu p. |
| free,banner,exchange,swap,trade,skyscraper,text,bonus,credits,ads,advertising,link,bannerexchange,ba nner-exchange,pro,professional,hit,hits,click,clicks,promote,promotion |
| banner, exchange, generation, yesnexus |
| (SLD : yesnexus.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Traffic Jam Network |
| Traffic Jam Network-Free Banner Exchange & Web Ring |
| http://trafficjamnetwork.8m.com/ |
| Basic banner exchange. [Ratio: 2:1 Banner Sizes: 468x60] |
| The first Free Banner exchange of it's type, not only a banner exchange but a webring as well. An ex cellent ratio of 1:1. We offer you guaranteed hits |
| free banner exchange, free web ring, free link exchange |
| border, 3366cc, background, family |
| (SLD : 8m.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| BannerBuild |
| BannerBuild.com - banner ads professionals |
| http://www.bannerbuild.com/ |
| Company offers to render professional banner design services for companies, organization or personal web site. Develop both animated and static banners. |
| We offer to render professional banner design services for your company, organization or personal we b site. Our objective is to provide you with effective banners in order to help you attain the best value for your online advertising budget. |
| banner, banners, banner design, banner design services, banner ad, banner ads, banner ad design, ban ner advertising, banner advertisement, banner experts, banner exchange, professional banner design, click through, CPM, CPC, impressions, banner impressions, advertise, advertisement, clicks, click-th rough, click-thru, link-exchange, linkexchange |
| banner, banner, design, website, services, bannerbuild, retractable, design, advertising, contact, b anners, helpful, samples, uninitiatedbanners, traffic, inquiries, privacy, policy, websitehow, desig ns, contact, through, questions, articles, sitemap, feedback, please, template, business, online, se arch, copyright, canadian, banners, display, operated, icthus, communications, reserved, rights, lab els, address, imprint, succeed, techniquehow, adsbanner, promotional, around, promotional, return, r eputationdefender |
bannerbuild.com - rank der domain 985548 (17503 in CA)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Bannertoko.nl |
| Banner ontwerp van Bannertoko.nl |
| http://www.bannertoko.nl |
| Ontwerpstudio gespecialiseerd in webvertising. Ontwerpt banners, landingpages en nieuwsbrieven. |
| Bannertoko.nl is een professionele banner ontwerp studio. Ontwerp van webvertising: banners, nieuwsb rieven landingspages en minisites. |
| ontwerp banner, banner, ontwerp, concept, design, productie, bannertoko, benner, banner ontwikkelin g, banner makers, banner maken, video banner |
| ontwerp, ededed, swfobject, flashid, button, banners, bannertoko, webvertising, home120x90, home728x 90, home468x60, banner, portfolio, banner, home120x60, home120x600, landingpages, nieuwsbrief, banne rtoko, ontwerp, 120x90, voorbeelden, voorbeeld, internet, banner, adverteren, design, gespecialiseer d, ontwerpstudio, daarvoor, bedenken, landingpages, ontwerpen, nieuwsbrieven, bekijk, opnemen, conta ct, portfolio, nieuwsbrief, landingspage, ontwerpom, meteen, tariefkaart, informatie, diensten, 8792 15, urchintracker, contact, leaderboards, realiseren, buttons |
| (SLD : bannertoko.nl) |
| World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners |
| zum Seitenanfang ↑ |
| Moto-Ads Banner Exchange |
| Moto-Ads - Site Targeted Banner Ads |
| http://www.moto-ads.com/ |
| Banner exchange program for motorcycle website promotion. [Ratio: 2:1 Banner Sizes: 468x60] |
| Site targeted Motocycle only banner advertising. Use banners to promote, advertise and increase traf fic to your Motorcycle related website. You can target and receive Motorcycle related visitor's to y our site. |
| motorcycle, motorcycles, honda, yamaha, kawasaki, suzuki, ktm, banners, banner exchange, banner adve rtising, advertise, banner rotation, banner swap, free banner exchange program, banner swap center, banner swap exchange program, ad banners, banner network, link exchange, bannerexchange, banner exch ange program, banner network, barter, exchange, resource marketing, e-commerce, home business, free advertising, small business, web promotion, web advertising, link, free link, business, hits, free b anner exchange, advertising banner program, advertising program. |
| mydate, motorcycle, nichebanners, advertising, draining, company, contextual, selling, advertiser, b udget, dirtbiketrader, section, rununtilsold, streetbikeads, dualsportads, simple, started, getting, keyword, advertising, buying, banner, clicking, getday, getmonth, getdate, getyear, business, custo mers, looking, banner, fortune, costing, targeted, targeted, opinion |
| (SLD : moto-ads.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest |
| zum Seitenanfang ↑ |
| Banner-Adverts |
| Banner hyphen Adverts Dot Com - Banner Advertising Network and Link Exchange |
| http://nnh.co.uk/ad-net/ |
| Banner advertising network and link exchange. [Ratio: 3:2 Banner Sizes: 468x60] |
| Welcome to the world of Internet advertising from Scotland's leading banner advertising and link exc hange network. Impressions and exposures where they count. |
| banner, ads, banners, free, exchange, promotion, impressions, scotland, advertising, click through, marketing, advertisements, web site, UK, Scotland, adverts |
| banner, exchange, network, hyphen, adverts, advertising |
nnh.co.uk - rank der domain 849711 (4993 in UK)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| BannersOnline.com |
| Banner Design | Flash Banner Design | Online Advertising Design | Create Banner | Bannersonline.com |
| http://www.bannersonline.com/ |
| Custom web banner ads or logo design. |
| We specialize in banner design and flash banner design. Learn about our online advertising design se rvices, including web design and website development, at Bannersonline.com. |
| Banner Design, Flash Banner Design, Online Advertising Design, Create Banner, Bannersonline.com |
| design, banner, bannersonline, create, online, advertising |
bannersonline.com - rank der domain 745024 (325961 in US)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Banner Monkeys |
| Banner Ad Design by the Banner Monkeys |
| http://www.bannermonkeys.com/ |
| Creates static and animated banner designs for commercial websites. Includes sample banners. |
| 100% Satisfaction Guaranteed. Custom animated banner and banner ad designs. This dedicated graphics team has helped thousands of companies improve their business and corporate image online. |
| banner ad design animated web banner |
| banner, banner, design, internet, advertising, business, banners, making, loading, create, online, b anners, design, buyers, within, considerations, designers, pitfalls, convert, detect, creating, prom otions, surfers, campaigns, vision, personalized, approval, review, working, changes, arrived, satis fied, internet, information, attention, product, statement, optimize, creators, custom, affordable, effective, generator, animated, bannermonkeys, resources, samples, monkeys, guarantee, animated, cus tom |
| (SLD : bannermonkeys.com) |
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Bannerset.com |
| Creazione banner, set di banner e pop up pubblicitari personalizzati |
| http://www.bannerset.com/ |
| Illustra i servizi relativi alla creazione di banner pubblicitari, animazioni e pop-up per i siti, c onsentendone l'acquisto online con varie forme di pagamento. |
| Creazione banner, set banner e animazioni . Acquisto on line con varie forme di pagamento. |
| creazione banner set pubblicitari personalizzati pop up pubblicitarie pacchetti vendita gif swf anim azioni dimensioni standard realizzazione a bassi costi veloci pagamenti |
| decoration, banner, spostato, position, visited, absolute, creazione, personalizzati, pubblicitari, 6d7077 |
bannerset.com - rank der domain 957602 (18255 in IT)
|
| World/Italiano/Acquisti_Online/Elettronica_di_Consumo/Computer |
| zum Seitenanfang ↑ |
| HIOX Free Banner Ad Rotator |
| Banner Rotator / Ad Rotater, Rotate Image - Free PHP Script |
| http://www.hscripts.com/scripts/php/bannerRotator.php |
| A banner rotator script to dynamically add, update and ratoate banner ads. File based utility PHP sc ript with options to set banner size, time between rotation and ad management. [Freeware] |
| HIOX PHP SCRIPTS, free image rotation script using php.
This free banner rotate script is developed using php and javascript. |
| banner image rotating, banner rotator, free auto banner rotation,
banner rotation php, php banner ro tating script, time based banner rotation, how to rotate image,
rotate banner, rotate image javascri pt |
| document, background, family, window, verdana, bubble, function, script, decoration, elementref, ima ges, padding, layername, margin, getelementbyid, tutorials, position, hscripts, tooltip, timeon, scr ipts, repeat, offsetparent, banner, visibility, weight, border, itemname, menuactive, corner, onlaye r, relative, curleft, hidelayer, curtop, linkar, settimeout, colnow, layers, pwidth, pheight, ffffff , banner, sidebar, setattribute, bookmark, bottom, images, color1, bottomright, rotate |
hscripts.com - rank der domain 17387 (6455 in US)
|
| Computers/Programming/Languages/PHP/Scripts/Ad_Management |
| zum Seitenanfang ↑ |
| AdBanner.ro |
| Retea de banner exchange gratuita rata 1:1 |
| http://www.adbanner.ro |
| Reţea publicitară de banner exchange |
| Promovare online gratuita prin retea de banner exchange |
| banner, banner exchange, bx, publicitate |
| gratuita, banner, exchange |
| (SLD : adbanner.ro) |
| World/Română/Computere/Internet/Design_şi_dezvoltare_Web/Promovare/Publicitate,_bannere_şi_schimburi |
| zum Seitenanfang ↑ |
| Business Banner Design |
| Business banner design, exclusive banners |
| http://banner-design.narod.ru/ |
| Specializes in business banner design in following formats .gif, .jpg, .swf (Flash), .htm. |
| realGRAPHICS specializes on the business banner design. We create really exclusive banners. - 15 |
| business banner design, exclusive banners |
| banners, banner, exclusive, realgraphics, business, design, business, display, through, extremely, s erver, access, blocked, catalog, directory, 4clever, member, online, samples, exlusive, partners, de signing, working, following, formats, really, create, banner, design, specializes, effectively, excl usive, presupposes, effective, offers, development, effective, creation |
narod.ru - rank der domain 308 (12 in RU)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| Scambio di banner |
|
| http://www.scambio-di-banner.com |
| Circuito gratuito per banner 468x60 con rapporto 2 a 1 di impression, personalizzabile e con targeti ng per categorie. |
| |
| |
| |
| (SLD : scambio-di-banner.com) |
| World/Italiano/Computer/Internet/Marketing/Scambio_Banner |
| zum Seitenanfang ↑ |
| Banner.Site.KZ |
| |
| http://banner.site.kz/ |
| Казахская баннерная сеть. Формат 100х100, комиссия 15%, перевод без комиссии. |
| |
| |
| banner |
site.kz - rank der domain 786679 (26853 in RU)
|
| World/Russian/Компьютеры/Интернет/Дизайн_и_разработка_сайтов/Продвижение_сайтов/Баннерные_сети/Региональные |
| zum Seitenanfang ↑ |
| Accent Banner |
| Accent Banner - Authentic, handmade, New England. |
| http://www.accentbanner.com/ |
| Designs and produces banners, drapes, soft signage, and flags through applique, screen printing, dig ital printing, and dye sublimation. |
| Accent Banner, LLC |
| Accent Banner, LLC |
| banner, accent, service, homeproducts, servicesgalleryabout, boston, uscontact, custom, university, banner, greater, flagpole, privacy, reserved, shipping, return, policy, rights, installation, specia lists, copyright, retail, providing, mystic, medford, noconflict, handmade, authentic, england, jque ry, choice, quality, usshop, budget |
| (SLD : accentbanner.com) |
| Business/Business_Services/Signage/Promotional |
| zum Seitenanfang ↑ |
| Air Signs and Banners |
| Aerial Advertising - Banner Towing - Chicago - Milwaukee - Air Signs & Banners |
| http://www.airsignsandbanners.com/ |
| Aerial banner and billboard towing. |
| Aerial Signs & Billboards break the indifference barrier in consumer advertising by putting you r name above the competition.We serve Wisconsin,Iowa,Illinois and Minnisota. We also offer banner t owing chicago, |
| aerial advertising chicago, advertising aircraft,advertising airplane,aerial ads,aerial advertising, aerial banner,aerial banner towing,aerial banners,aerial billboards,aerial campaign,aerial marketing ,aerial signs,aerial tow banners,aerial towing,affordable advertising,air ads,air banners,air messag e,airplane ads,airplane advertising,airplane banner,airplane banner advertising,airplane banner towi ng,airplane banners,airplane billboard,airplane message,airplane pulling a banner,airplane sky ads,a irplane with banner,ariel advertising,aviation ads,aviation advertising,banner tow,banner towers,ban ner towing,banner towing company,banner towing illinois,banner towing milwaukee,banner towing madiso n,banner towing chicago,banner towing wisconsin,beach ads,beach advertising,beach banners,billboard towing,billboards,flying ads,flying advertising,flying banner,flying billboards,marriage proposals,o utdoor advertising,sky messages,message towed behind airplane,plane ads,plane advertising,plane bann ers,political campaign a |
| banners, 629616, urchintracker, advertising, aerial, banner, towing, milwaukee, chicago |
| (SLD : airsignsandbanners.com) |
| Regional/North_America/United_States/Wisconsin/Localities/R/Racine/Business_and_Economy/Business_Services |
| zum Seitenanfang ↑ |
| International Banner Exchange |
| Welcome to INT-BE.Com - International Banner Exchange - |
| http://www.int-be.com/ |
| Banners targeted by country, language, and category. [Ratio: 1:1 per display, 3:4 per click, Banner Sizes: 468x60] |
| |
| |
| banner, welcome, international, banner, exchange, credits, website, promote, unlimited, please, copy right, information, consult, contact, websites, background, 4b5b79, e6e6ff, family, verdana, 0e4980, password, pixels, display, credit, format, target, country, language |
| (SLD : int-be.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Regional |
| zum Seitenanfang ↑ |
| Banner-buttonservice |
| |
| http://www.banner-buttonservice.nl/ |
| Groot aanbod van banners en logo's om je website te promoten. |
| banner-buttonservice |
| banner maken,banners,buttons,logos,reklame,website,flash klokjes, |
| decoration, visited, silver, design, underline, klokje, kopieren, margin, center, border |
| (SLD : banner-buttonservice.nl) |
| World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners |
| zum Seitenanfang ↑ |
| Indigo-banner |
| Indigo banner |
| http://www.indigo-banner.dk |
| Bannerbytte som tilgodeser websteder der ikke overdriver deres bannervisninger. Eksponering i egen k ategori og med egen statestik, ingen animerede bannere. Siden skal være med alternativt indhold, her under vegetarsider, sundhed, hjælpeorganisationer og dyrevelfærd. |
| |
| |
| regler, forside, indigo, banner |
| (SLD : indigo-banner.dk) |
| World/Dansk/Edb/Internet/På_nettet/Bannerbyt |
| zum Seitenanfang ↑ |
| 007 Ad Banner Exchange |
| 007 Ad Banner Exchange |
| http://007adbannerexchange.freeworldz.net/ |
| Sites are not verified before joining. [Ratio: 2:1 Banner Sizes: 468x60] |
| |
| |
| banner, banner, exchange, password, displayed, thousands, credit, advertising, information, websites , pixels, joining, completely, service, charged, promotional, hosted, freeworldz, member, credits, h appen, someone, another, member, visits, spending, across, welcome, without, better, people, instant , website, promoting, painlessly, absolutely, impressions, potential, performance, statistics, detai led |
| (SLD : freeworldz.net) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Banner.dk |
| |
| http://www.banner.dk/ |
| Giver 2:1 visning, med mulighed for op til 40 forskellige bannere, og flere forskellige bannerstørre lser. |
| |
| |
| danmarks, banner |
| (SLD : banner.dk) |
| World/Dansk/Edb/Internet/På_nettet/Bannerbyt |
| zum Seitenanfang ↑ |
| Flex Banner |
| |
| http://www.flexbanner.com/ |
| Basic banner exchange. [Ratio: 2:1 Banner Sizes: 468x60] |
| |
| |
| discontinued, flexbanner |
| (SLD : flexbanner.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| BBS Xchange |
| BBS Xchange - BBS Banner Exchange - The one and only banner exchange for BBS-related sites. |
| http://bbsx.thebbs.org/ |
| Banner exchange for BBS-related sites. |
| |
| |
| banner, xchange, related, clicked, average, ratios, exchange, number, through, chance, greater, beca use, currently, exchanges, before, almost, clicks, person, between, someone, banners, second, severa l, advantages, programs, member, banner, banners, nothing, exchange, therefore, picked, randomly, ac cepted |
thebbs.org - rank der domain 900349 (386788 in US)
|
| Computers/Bulletin_Board_Systems |
| zum Seitenanfang ↑ |
| EasyStands Limited |
| Easy PopUp, Easy Rollup, Easy Roll Banner, Quick+Easy Rollup, Low-price Rollup, Easy Banner, Easy Banner Cassette, Water Flag, Flying Banner, A-Board, Snap Frame |
| http://www.easystands.com/ |
| Manufacturer of portable display stand equipment including banners and pop-ups. |
| |
| |
| banner, rollup, flying, cassette |
| (SLD : easystands.com) |
| Business/Business_Services/Event_Planning_and_Production/Convention_and_Trade_Show_Services/Exhibit_and_Display_Vendors/Portable_and_Modular_Displays/Manufacturers |
| zum Seitenanfang ↑ |
| Hey Banner Banner |
|
| http://heybannerbanner.com/ |
| Specializing in web site design and development, banner ad design, internet advertising, promotion, and eCommerce solutions. Includes a portfolio and a quote request form. |
| |
| |
| |
heybannerbanner.com - rank der domain 301524 (115428 in US)
|
| Regional/North_America/United_States/Kentucky/Localities/O/Owensboro/Business_and_Economy/Computers_and_Internet |
| zum Seitenanfang ↑ |
| Ad Butler |
| Ad Butler - Banner Rotation / Ad Serving Software |
| http://www.adbutler.com |
| Free or Paid; feature-rich ad server solution to manage advertising for a web site. |
| Ad Butler offers banner rotation and advertising management software. |
| banner management software, banner rotation software, banner ad server, advertising serving, ad serv er, banner rotate, banner rotating, banner cycle, banner cycling, ad rotation, ad rotate, ad rotatin g, ad serve, ad server, ad serving, advertising management, advertising rotation |
| butler, server, serving, serving, sparklit, hosting, survey, hosted, service, impressions, continuou s, single, should, targeting, another, device, rotation, banner, custom, software, support, failure, affect, provide, process, automatically, clients, featured, functioning, workload, deliver, failove r, clustered, affiliate, banner, tolerant, shifts, called, enterprise, billions, offers, website, sc ales, thousand, advanced, reporting, availability, reliableusing, options, detailed, control |
adbutler.com - rank der domain 154037 (59111 in US)
|
| Computers/Software/Internet/Servers/Advertising/Remotely_Hosted |
| zum Seitenanfang ↑ |
| The Banner Generator |
| The Banner Generator |
| http://www.coder.com/creations/banner/ |
| Banner creation from templates, with customizable options. |
| The Banner Generator is a free service provided by Prescient Code Solutions. The Banner Generator al lows web users to create graphic banners to head their web pages. Choose from a variety of fonts an d run advanced algorithms to make your banner stand out. |
| banner generator,banner,banners,web,create,graphics,graphic,headline,homepage,label,title,button,but tons,fonts,font,ad,ads |
| banner, generator, banner, server, information, center, service, please, making, written, imagemagic k, graphics, solutions, paypal, banners, support, create, internic, graphical, graphic, network, bec ause, outage, sponsors, creations, frequently, registration, properly, timely, change, please, maint aining, registry, domains, fashion, suffer, frustrations, experienced, owners, company, website, res ponsible, choose, policy, privacy, feedback, questions, information, sponsorship, examples, document ation |
coder.com - rank der domain 513705 (8923 in CA)
|
| Computers/Internet/Web_Design_and_Development/Authoring/Online_Tools/Graphics/Image_Generation |
| zum Seitenanfang ↑ |
| Banner Maker Pro |
| Banner Maker Pro - Create any banner ad, web header, button, logo, mobile banner, image ad, animated gif or web graphic quickly and easily. Design a banner in any size and add any image. Free Trial. |
| http://www.bannermakerpro.com/ |
| Creates banner ads, buttons, and other web based graphics. |
| Banner Maker Pro creates banner ads, web buttons, web graphics, web headers, logos, image ads, mobil e banner ads, and animated gifs quickly and easily. Free trial. |
| banner, ad, maker, create, web header, animation, design, button, make, gif, animated gif, banner so ftware |
| images, banner, banner, graphics, different, animated, version, create, buttons, create, released, b utton, minutes, banners, easily, making, backgrounds, animations, allows, graphic, website, addition al, details, expert, quality, faster, include, hundreds, preview, windows, image6, shapes, addition, looking, transparency, image2, sample, image4, image1, online, image3, program, headers, buttons, q uickly, image5, newfilename, imagenum, aliasing, blended, resized |
bannermakerpro.com - rank der domain 138633 (54721 in US)
|
| Computers/Software/Graphics/Image_Manipulation |
| zum Seitenanfang ↑ |
| BannerFiles |
| Banner Management Tool |
| http://www.bannerfiles.com/ |
| An advertising and banner delivery system support rotating any ad size, pop-ups, pop-unders, adverti sing network code, HTML ads. [Commercial] |
| Bannerfiles is a powerful ad server used to increase advertising revenue by allowing you to rotate m ultiple banner and pop-up ads across your website. |
| online banner advertisement, banner ad serving, banner reports, statistics, advertisers, publishers, ad campaigns, ad scheduling,Text Ad, geographical targeting,Region ad, zone ad,ad banner location,ro tate multiple banner,multiple domains ad, sell banner, banner rotation, banner management |
| scrollbar, banner, regular, 000000, software, advertising, campaigns, bannerfiles, banners, advertis ers, module, campaign, medium, revenue, source, support, contact, scrollbar, scheme, billing, managi ng, delivered, through, brings, servers, existing, prerequisite, integrating, option, impressions, f eatures, distinct, manage, bannerfiles, sandeshjain92, website, correct, begining, served, managemen t, having, million, reports, better, feedback, enough, provided, commitment, useful, testimonial, ex tremely |
| (SLD : bannerfiles.com) |
| Computers/Programming/Languages/PHP/Scripts/Ad_Management |
| zum Seitenanfang ↑ |
| Banner Co-op |
| BannerCo-Op.com - 1 for 1 Exchange Plus Cash |
| http://bannerco-op.com/hotbanners/ |
| Banner exchange plus CPM rate. [Ratio: 1:1 Banner Sizes: 468x60] |
| Banner Co-Op offers a unique banner exchange, where members joining the banner network can get free banners, and may purchase discounted and guaranteed click thrus, with banner design and banner adver tising help from the co-op members, and can leverage their impressions to increase traffic & visitor s through this free membership oriented link exchange organization. |
| banner,exchange,link,exchange,bannerco-op,banner,co-op,banner,marketing,advertising,clicks,internet, banners,impressions,click,web page promotion,click thrus,banner co-op,bannerexchange,linkexchange |
| banner, members, member, membership, sponsor, purchase, visitor, credit, bannerco, bannerco, unique, always, choose, inside, advertising, support, single, install, through, appear, special, visits, ad vertisers, details, earning, purchase, benefits, partnership, exchange, options, designed, program, membership, please, provided, simply, latest, resources, 250x72, recommended, animated, opportunity, review, before, continue, generously, anywhere, sponsored, incentive, advertising, resources |
bannerco-op.com - rank der domain 922527 (16495 in CA)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| The Free Auction |
| The Free Auction - Banner Exchange Program |
| http://www.thefreeauction.com/help/banner.html |
| Banner exchange with advanced statistics. [Ratio: 3:2 Banner Sizes: 468x60] |
| An online banner exchange program for the free auction users. |
| |
| banner, exposure, banner, program, website, exchange, banners, program, exchange, someone, auction, automatically, registration, exposures, receive, member, design, auction, accept, quality, related, hacking, advertise, difference, please, message, bulletin, justme, newsletter, advertise, account, s chmid, copyright, graphics, search, monthly, password, change, closed, auctions, feedback, closing, automatic, provides, required, viewed, credits, exchanges, placed, programs, software |
thefreeauction.com - rank der domain 972228 (417480 in US)
|
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| China Yixin Industry Corp.Ltd |
| Bannerofchina - Banner Maker of Vinyl Banner Printing Vinyl Graphic Sign Banner Custom Banner Printing |
| http://www.bannerofchina.com/ |
| Provider of vinyl graphics, digital printing and screen printing of banners, vehicle graphics, windo w art and general signage. |
| Vinyl Banner Sign Printing Banner Maker Large Format Digital Printing Vinyl Graphic Signage Screen P rinting Custom Banner Cheap Sign Trade Show Banners Cheap Banner Vehicle Graphic Pole Banner Mesh Ba nner Wall Mural |
| banner maker vinyl graphic cheap banner full color vinyl banner printing |
| banner, printing, bannerofchina, graphic, printing, banner, companies, testimonials, contact, custom er, products, backdrops, limitless, screen, 360dpi, 720dpi, material, fencing, superior, products, c opyright, unbeatable, satisfaction, multitude, indoor, substrate, outdoor, delivery, urchintracker, speedy, pricing, turnaround, 351539, delivery, timely, effectively, worldwide, quality, duratrans, s tickers, backlit, window, vehicle, flying, displays, various, printing, stands, mobile, billboard, b uilding |
| (SLD : bannerofchina.com) |
| Business/Business_Services/Signage/Vinyl |
| zum Seitenanfang ↑ |
| Banner Lakes at Summerset State Park |
| IA DNR: Banner Lakes at Summerset |
| http://www.iowadnr.com/parks/state_park_list/banner.html |
| Provides a 222-acre setting nestled in the rolling landscape between Des Moines and Indianola on Hig hway 65/69. Activities include picnicking, bicycling, mountain biking, boating, fishing and shooting range adjacent to the park. Includes map. |
| |
| |
| summerset, banner |
| (SLD : iowadnr.com) |
| Regional/North_America/United_States/Iowa/Localities/I/Indianola/Recreation_and_Sports |
| zum Seitenanfang ↑ |
| 1 Day Banner, Inc. |
| Vinyl Banners Printed by 1 Day Banner |
| http://www.1daybanner.com |
| Specialize in digitally printed vinyl banners. Online design available. |
| Low-Priced Digitally Printed Vinyl Banners Shipped In 1 Day. Guaranteed! Design Your Banner Online o r Choose from Custom, Text or hundreds of Stock Banners such as Birthday Banners or Grand Opening Ba nners. |
| banner, banners, vinyl banner, vinyl banners, custom banner, custom banners, online banner, online b anners, stock banner, stock banners |
| keystr, banner, banner, charat, charcodeat, pagetracker, output, samples, better, banners, reinforce d, printing, gajshost, document, writes, banners, printed, 1daybanner, perfect, received, impressed, absolutely, carolina, ordered, finished, follow, within, chapel, service, ordering, checkout, 3cscr ipt, unescape, google, analytics, location, protocol, gettracker, 1017070, initdata, trackpageview, script, javascript, resource, ultimate, website, testimonials, quickly, delivered, register, copyrig ht |
1daybanner.com - rank der domain 966159 (386808 in US)
|
| Business/Business_Services/Signage/Flags_and_Banners |
| zum Seitenanfang ↑ |
| Bannerite.com |
| Bannerite.com |
| http://www.bannerite.com/ |
| HTML email, banner ad, web site and landing page design studio. |
| web banner ad design, flash banner design and html email design |
| doubleclick ad design, html email, banner ad design, web banner design, html email design, flash ban ner, banner, newsletter templates, web design |
| client, website, bannerite, banner, create, portfolio, business, homeflash1, images, uploads, replac ed, design, prices, landing, ultimate, follow, starting, mymovie, swfobject, whathelps, products, wo rking, pleasure, services, 738801028, copyright, contact, making, client, testimonial, flashcontent, ffffff, goodness, cannot, taking, impressed, animated, complex, classic, design, development, cente red, specific, attention, outstanding, customer, service, covers, design, driven, bannerite |
| (SLD : bannerite.com) |
| Computers/Graphics/Web |
| zum Seitenanfang ↑ |
| Banner of Love |
| Banner of Love |
| http://www.banneroflove.net/ |
| A religious publication, created, edited, and published in the interests of the Primitive Baptist Ch urches throughout the United States of America. Established in 1932. |
| |
| |
| browser, support, frames, banner |
| (SLD : banneroflove.net) |
| Society/Religion_and_Spirituality/Christianity/Denominations/Baptist/Baptist_Groups/Primitive_Baptists |
| zum Seitenanfang ↑ |
| Banner-printer.com |
| Banner printing: Making custom vinyl banners. |
| http://www.banner-printer.com/ |
| Vinyl banners and four color vinyl banner printing. |
| Vinyl Banners and Banner Printing - Order Online, Fast and easy custom vinyl banners. Wholesale bann er printing. |
| Banner printing,printed banners,vinyl banners,Banner Maker,Signs and banners,vinyl,signs,wholesale b anner maker,silk screen printing,digital print,silkscreen,banner company,street banners |
| banner, banners, printing, banner, custom, online, printer, printing, banners, compare, prices, deci ding, outdoor, poster, selection, customers, quality, products, affordable, digital, gallery, fulfil l, transactions, private, secure, credit, contact, satisfaction, processing, encrypted, secure, whol esale, shipped, within, orders, orders, ordering, pricing, retail, problems, wholesale, ordering, mi ddleman, making, outdoor, screen, indoor, lettered, testimonials, printed, poster |
banner-printer.com - rank der domain 520312 (209949 in US)
|
| Business/Business_Services/Signage/Vinyl |
| zum Seitenanfang ↑ |
| Solodomini.it Scambio Banner |
| SOLO DOMINI.IT SCAMBIO BANNER |
| http://www.solodomini.it/ad/ |
| Rapporto di scambio 1:1. 1000 visualizzazioni all'iscrizione e 20.000 visualizzazioni gratis se il c odice HTML viene posizionato sulla home page del sito. |
| SOLO DOMINI.IT SCAMBIO BANNER |
| SOLO DOMINI.IT Scambio Banner |
| banner, scambio, domini |
solodomini.it - rank der domain 999440 (18386 in IT)
|
| World/Italiano/Computer/Internet/Marketing/Scambio_Banner |
| zum Seitenanfang ↑ |
| RISC OS Banner Network |
| RISC OS Banner Network |
| http://banners.iconbar.com/ |
| Banner exchange for RISC OS related web sites, commercial and non-commercial banners accepted. [Rati o: 2:1 Banner Sizes: 468x60] |
| |
| |
| banner, banners, banner, network, commercial, accepted, ensure, commercial, duffell, password, pleas e, permenant, somewhere, uploaded, otherwise, networkrisc, display, displayal, incorrect, questions, problems, webmaster, hosted, system, cannot, faliure, responsible, barjohn, financial, receive, dis playing, church, forgot, exchange, member, related, websites, saints, create, welcome, always, membe rs, connected, andrew, software, treated |
| (SLD : iconbar.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest |
| zum Seitenanfang ↑ |
| Banner Push |
| Banner Push Network - Free Banner Exchange and Search Engine Submission Service |
| http://www.bannerpush.net/ |
| Supports flash banners. [Ratio: 3:2 Banner Sizes: 468x60] |
| Join our Free Banner Exchange Network that has a 3:2 banner ratio, and receive 5000 free banner cred its. Try several of our free services, link with us or join our FFA page. |
| free banner exchange,marketing, banner exchange, advertising, free banner exchange, advertise, bann er exchange, flash banners, advertising, ffa, links, web promotion, website promotion, flash banners ,free banner exchange, banner exchange, marketing, advertising, free banners, banner ads, advertisi ng, web marketing, internet marketing,web promotion, internet advertising, banner ads, bannerpush, b anner push exchange,ffa, links, FFA, banner exchange, free banner exchange, free banners, free banne r exchange, website, promotion, search engine,submit, url, internet, tools, webtools, promote, banne r exchange, free banner exchange, banner ads, free banners, advertise, submission, links,listing, tr affic boost, resources, business, advertise, search engine positioning, web promotions, search engin e placement,increase visitors, web advertising |
| banner, exchange, mimetypes, useflash, navigator, shockwaveflash, services, members, shockwave, avai lable, application, getting, promotion, attract, actually, audience, exchange, banner, service, memb ers, allows, traffic, website, generating, provide, services, packages, nonflash, replace, location, privacy, policy, resources, questions, createobject, service, submission, engine, search, enabledpl ugin, isnull, resume, engines, contact, bannerpush, network, welcome, promotion, millions, credits, plenty |
| (SLD : bannerpush.net) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Matrix Design Communication |
| Banner Stands, Exhibition Pop Up, Display Stand, Roller Banners Printing |
| http://www.design-matrix.co.uk/ |
| A design, sign and print company offering a wider range of services at competitive prices. United Ki ngdom. |
| Exhibition stands and pop up display banner stands and roller banner stand to printed banners for ex hibition display. pop up banner printing UK |
| banner stands, exhibition, display, exhibition stands, pop up stands, printed, design, roller banner , banners, banner, pop up banner, printing |
| stands, banners, banner, display, exhibition, banner, roller, exhibition, stands, stands, exhibition , display, banners, banner, printing, design, design, london, portable, design, service, promotional , banners, printing, printing, marketing, advertising, printed, outdoor, roller, printed, company, d isplays, systems, budget, central, supply, events, guarantee, selection, display, information, displ ays, external, designed, complete, offers, requirements, available, displays, delivered |
design-matrix.co.uk - rank der domain 928223 (29817 in GB)
|
| Business/Business_Services/Event_Planning_and_Production/Convention_and_Trade_Show_Services/Exhibit_and_Display_Vendors/Portable_and_Modular_Displays/M |
| zum Seitenanfang ↑ |
| Welcome to Banner County, Nebraska |
| Banner County Official Web Page |
| http://www.co.banner.ne.us/ |
| Links to county history, its weather, public events, also information about County programs and serv ices, with an FAQ section. |
| |
| |
| county, banner, leaves, vistabeam, thanks, contact, administrator, giving, kindly, treating, larsen, pictures, poison, different, nebraska, official, tlxpgnm, places, sprayed, pattern, picture, distin ctly |
| (SLD : ne.us) |
| Regional/North_America/United_States/Nebraska/Counties/Banner |
| zum Seitenanfang ↑ |
| BannerNet |
| BannerNet - Circuito di scambio banner |
| http://www.bannernet.altervista.org |
| Circuito di scambio banner, rapporto 1:1 per banner di dimensioni 468x60 |
| Bannernet circuito di scambio banner gratis 1:1 |
| bannernet, circuito, scambio, banner, free, gratis, 1:1 |
| bannernet, register, contact, banner, circuito, scambio |
altervista.org - rank der domain 550 (9 in IT)
|
| World/Italiano/Computer/Internet/Marketing/Scambio_Banner |
| zum Seitenanfang ↑ |
| Mediaform |
| Mediaform. We Print Plastic. |
| http://www.mediaformusa.com |
| Specialists to broadcast industry. Products include contracts, statements, banners, plastic roll ban ners, checks, invoices, police tape, stationery products, and posters. |
| Mediaform. We print plastic. 800-257-3307. Manufacturer of plastic roll banners & manufacturer of vi nyl banners. Mediaform can provide you with all your plastic printing needs and event needs. Mediafo rm banners and bags. Mediaform delivers high-quality printed plastic roll banners, vinyl, large for mat banners and grand format banners, and bags used for promotions and packaging. We print plastic f or clients through out the US. Specialists to the broadcast industry |
| Mediaform Banners & Bags | Plastic & Vinyl Roll Banners, Plastic Bags banner on a roll, banner roll, banner wrap, Banners & Bags, banners on a roll, Banners, cheap plastic banner, continuous printed l ogo on roll, continuously printed logo, custom banner, custom made banner, custom outdoor banner, cu stom printed roll banner, custom roll banner, disposable banner on roll, disposable banner, economic al banner, event banner, event tape, Large Format Banners, logo on roll, outdoor banner display, out door event banner, outside banner, plastic advertising banner, Plastic Bags, plastic banner, plastic roll banner, Plastic roll banners, plastic sign banner, premium vinyl banner roll, printed roll ban ner, promotion banner, promotional banner roll, promotional banner rolls, promotional banner, promot ional banners, promotional vinyl banner, radio station promotional banner, roll banner roll sign, ro ll up banner, sign banner custom, Vinyl Roll Banners |
| pagetracker, gajshost, mediaform, special, document, design, location, protocol, genius, company, ou tsidehub, design, maintenance, script, javascript, gettracker, trackpageview, initdata, 4893491, geo rge, 3cscript, unescape, google, analytics, friendly, savings, advantage, plastic, offers, samples, request, corporate, groups, products, contact, partner, business, everything, promotional, quality |
| (SLD : mediaformusa.com) |
| Business/Publishing_and_Printing/Printing/Products |
| zum Seitenanfang ↑ |
| LemNet.com Banner Exchange |
| Free Guestbooks, Banner Exchange and anti-spam tools - LemNet.com |
| http://www.lemnet.com/ |
| Free banner exchange and related services. [Ratio: 10:7 Banner Sizes: 468x60] |
| |
| |
| signup, website, visitors, guestbooks, address, banner, messages, feedback, exchange, banner, spamme rs, private, through, vulnerable, leaves, invaluable, visitor, feedback, publishing, sponsered, skyd ive, courses, parachute, please, instead, service, relevant, issues, policy, adverts, displays, retu rn, design, promoting, tested, services, privacy, details, comments, museum, guestbook, members, con tact, websites, usernamepassword, lemnet, interactivity |
| (SLD : lemnet.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges |
| zum Seitenanfang ↑ |
| Design Print Banner LLC |
| Vinyl Banners, Custom Vinyl Banner Printing, .99/SF Vinyl Banners |
| http://www.bannerbuzz.com/ |
| Digital banner printing and trade show vinyl banners. |
| Vinyl Banners, .99/Sq.Ft. Custom Vinyl Banner Printing with Heavy Duty 15 oz Vinyl, Full Color Vin yl Banners with Free Design Proof, Low Flat Rate Shipping, 100% Quality and Best Price Guarantee. |
| Banner, banners, vinyl banner, vinyl banners, banner printing, banners printing, custom banner, cust om banners, vinyl banner printing, vinyl banners printing |
| location, sergyc, banners, height, border, guarantee, sergycs, document, design, bannerbuzz, script, scroll, window, winprops, screen, prices, hintbox, projects, period, published, margin, quality, pr oofs, business, verdana, normal, hidden, hintanchor, bottom, e0dede, visibility, background, absolut e, default, onmouseover, weight, padding, position, support, javascript, createelement, shipping, de tails, function, newwindow, printing, custom, banner, scrollbars, navigator, appversion |
bannerbuzz.com - rank der domain 84404 (32597 in US)
|
| Business/Business_Services/Signage/Flags_and_Banners |
| zum Seitenanfang ↑ |
| Banner Maker Pro |
| Banner Maker Pro - Create any banner ad, web header, button, logo, mobile banner, image ad, animated gif or web graphic quickly and easily. Design a banner in any size and add any image. Free Trial. |
| http://www.bannermakerpro.com/ |
| Creates banners, buttons, and other Web graphics. [Win95/98/Me/NT/2000] |
| Banner Maker Pro creates banner ads, web buttons, web graphics, web headers, logos, image ads, mobil e banner ads, and animated gifs quickly and easily. Free trial. |
| banner, ad, maker, create, web header, animation, design, button, make, gif, animated gif, banner so ftware |
| images, banner, banner, graphics, different, animated, version, create, buttons, create, released, b utton, minutes, banners, easily, making, backgrounds, animations, allows, graphic, website, addition al, details, expert, quality, faster, include, hundreds, preview, windows, image6, shapes, addition, looking, transparency, image2, sample, image4, image1, online, image3, program, headers, buttons, q uickly, image5, newfilename, imagenum, aliasing, blended, resized |
bannermakerpro.com - rank der domain 138633 (54721 in US)
|
| Computers/Software/Shareware/Windows/Graphics |
| zum Seitenanfang ↑ |
| Bannerscapez |
| Bannerscapez: custom animated and free Banner Design |
| http://www.bannerscapez.com/ |
| Design services for static, animated and HTML banners. Professional web banners for every budget. |
| Award-winning banner design services for static, animated and HTML banners. |
| banners,design,creation,maker,designer,animation,static,html,banner advertising,banner ads,advertisi ng,banner creation,banner design,banner makers,freebanner,professional,free,gif,gifs,gif's,jpg,jpgs, jpg's |
| scapez, katekreates, webscapez, design, banner, bannerscapez, custom, animated |
| (SLD : bannerscapez.com) |
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| GratisBanners.nl |
| Home - Gratis Banner maken |
| http://www.gratisbanners.nl/ |
| Gratis banners voor je website maken met de generator. |
| Gratis banner maken, met behulp van mooie banner sjablonen en onze generator uw eigen banners simpel en snel. |
| banner, maken, banners, gratis, generator, online |
| generator, linkpartners, verdien, portfolio, contact, banners, banner, gratis, favorieten, toevoegen , homepage, gemaakt |
gratisbanners.nl - rank der domain 967065 (16654 in NL)
|
| World/Nederlands/Computers/Internet/Webdesign_en_Ontwikkeling/Promotie/Adverteren_en_Banners |
| zum Seitenanfang ↑ |
| My Fit Banner |
| :::: myfitbanner.com :::: Free Banner Exchange for fitness, health and wellness sites. |
| http://www.myfitbanner.com/ |
| Offering banner and link exchanges for fitness, sports, and health sites. [Ratio: 3:2 Banner Sizes: 468x60] |
| myfitbanner.com is a Free banner exchange for fitness, health and wellness sites. |
| free banner exchange, free link exchange, banners, banner design, link exchange, banner exchange |
| navigator, sissel, banner, myfitbanner, exchange, screen, fitness, design, netscape, appname, health , document, theragear, online, fitness, swissballs, swissball, canada, international, contact, blast er, rights, reserved, dolphin, creative, copyright, searchengine, bikeaccessories, lowrider, motoacc essories, motogp, lowriderbikes, lowriderbike, fussballbekleidung, motorcycleaccessory, motorcycleti res, tourcommunity, community, supermoto, procircuit, mountain, mountainbikes, custombike, classicbi kes, domains, bikecommunity, equipment, pilates, exercise, bikeaccessory, breakdance |
| (SLD : myfitbanner.com) |
| Computers/Internet/Web_Design_and_Development/Promotion/Advertising,_Banners,_and_Exchanges/Banner_Exchanges/Special_Interest |
| zum Seitenanfang ↑ |
| Hillsboro Banner |
| Welcome to the Hillsboro Banner |
| http://www.hillsborobanner.com/ |
| Online edition of the oldest weekly newspaper in North Dakota. |
| |
| |
| hillsboro, banner, report, hbanner, cabelas, website, including, content, directed, information, tra ill, school, catalog, county, website, public, property, questions, concerns, suggestions, copyright , tained, photography, welcome, caledonia, weather, community, medical, guestbook, glance, banner, c enter |
| (SLD : hillsborobanner.com) |
| Regional/North_America/United_States/North_Dakota/Localities/H/Hillsboro/News_and_Media |
| zum Seitenanfang ↑ |
| AnimatedBanner.com |
| Professional custom banner design for .00. - banner ad design and website development |
| http://www.animatedbanner.com/ |
| Custom animated banner designer. Includes samples of work, and FAQs. |
| Professional custom animated banner design for .00. Pay only if you like your banner. |
| |
| banner, design, custom, development, services, website, contact, custom, animated, banners, banner, obligation, designers, purchase, professional, internet, banners, online, project, standard, informa tion, process, provide, support, create, answer, service, before, static, premade, quality, professi onal, package, contact, universal, reputation, question, attractive, possible, general, compliant, p roducts, provides, projects, discounted, animatedbanner, charge, dedicated, rectangle, pricing, dire ct |
animatedbanner.com - rank der domain 902215 (370156 in US)
|
| Computers/Graphics/Web/Banners |
| zum Seitenanfang ↑ |
| BannerServer.com |
| Flash Banner, Flash Banners Design for online advertisement, Interactive flash ads, customizable, playable Banner design, flash intros |
| http://www.bannerserver.com/ |
| Offers flash banners, template and logo design and vector graphic production. |
| Flash Banners design service for online advertisement, collection of flash banner templates. Custom banner design service, also featured playable, interactive flash banners. |
| flash banner, flash banners design, flash logo, Banner Design for online advertisement, web banner d esign, banner design, banner design templates, Flash and GIF Banner Design, Interactive Banners, Log o Design, Button Design, Flash Intros, Flash Website Design, Standard flash Banner, Skyscraper,Small Rectangle Banner, medium rectangle banner, Leaderboard, custom banner design, customizable banners |
| banner, website, templates, design, builder, gallery, interactive, banner, banners, software, templa tes, design, required, software, banners, interactive, online, samples, calendar, template, custom, player, customizable, gallery, customization, services, marketing, 728x90, advertising, development, rectangle, attract, specialize, bannerserver, create, contact, a4desk, intros, please, intros, sele ct, playable, feature, different, clients, 160x300, skyscraper, 120x600, 300x250, 468x60, leader |
bannerserver.com - rank der domain 623506 (11590 in IN)
|
| Computers/Graphics/Web |
| zum Seitenanfang ↑ |
| Thai Link Exchange |
| Welcome to the ThaiLE.com |
| http://www.thaile.com/ |
| บริการแลกเปลี่ยน banner ฟรีพร้อมสถิต, บริการบริหาร banner บนเว็บของคุณ |
| ThaiLE.com - no.1 banner exchange network in thailand |
| thai,banner,exchange,ranking,promote,website,promote website, exchage banner |
| googeek, thaile, january, saturday, welcome, column, updated, monday, thunderbird, outlook, gallery, googeek, copyright, directorybanner, member, wrapper, mainnav, content, footer, margin, navigation, rightcollapsedefault, container, excludemodules, feature, second, hostpacific, header |
| (SLD : thaile.com) |
| World/Thai/คอมพิวเตอร์/อินเทอร์เน็ต/ออกแบบเว็บและการพัฒนา/โปรโมทเว็บไซต์ |
| zum Seitenanfang ↑ |
|
Sitemap.XML / Sitemap.HTML / search / Kontakt & Impressum / Domains
