| ADAM |
| ADAM, the Art, Design, Architecture & Media Information Gateway |
| http://adam.ac.uk |
| Gateway to art, design, architecture and media information on the Internet. Searchable database sele cted by professional art librarians. |
| |
| |
| images, preloadimages, humanties, version, resources, archived, intute, available, architecture, des ign, information, gateway, power2, about2 |
| (SLD : ac.uk) |
|
| zum Seitenanfang ↑ |
| Art Resources Directory |
| ArtistPortfolio.Net - Art Resources Directory |
| http://www.artresources.co.uk/ |
| Comprehensive directory of art resources for artists, galleries, and art collectors. The directory i s searchable by category and keyword. |
| |
| |
| google, height, 666666, efefef, sitecont, family, 7377463177930527, client, 333333, suggest, 728x15, format, border, channel, 4949955951, resources, document, directory, artistportfolio, privacy, poli cy, category, conditions, favourites, please, urchintracker, suggestions, submit, developer, freelan ce, recommend, report, problems, development, gettableend, artistportfolio, gettablebegin, services, search, images, weight, valign, advertising, contacts, hosting, councilsweb, portfolio, services, m ailing, normal, boards |
artresources.co.uk - rank der domain 996705 (32014 in GB)
|
|
| zum Seitenanfang ↑ |
| Art-Bridge.com |
| Art Directory, Art Links, Art Portal |
| http://www.art-bridge.com/ |
| A directory and searchable database of art resources on the Web. |
| Comprehensive directory and searchable database of art resources on the Web covers artists, animatio n, art galleries and museums, architecture, crafts, photography, digital art, etc |
| fine art, art portal, exhibitions, museums, galleries, artworks, photography, channels, resources |
| portal, directory |
art-bridge.com - rank der domain 863455 (371755 in US)
|
|
| zum Seitenanfang ↑ |
| Arts/Directories |
|
|
| Arts/Directories |
| zum Seitenanfang ↑ |
| Artcom Collector's Corner |
| Artcom |
| http://www.artcom.com/ |
| International featured artist, exhibitions, list of museums and other features of international scop e. |
| Artcom Collectors' Corner: museums, antiques, art, travels. Major exhibitions and auctions worldwide . This art site is remarkably graphic sensible and quick loading. |
| art, antiques, museums, art museums, travels, exhibitions, fountain, auctions, safari, relaxation, e xpos, exhibits |
| artcom, museums, artcom, museum, listing, museums, guestbook, visiting, sponsored, promote, contents , illinois, meadows, news01, rolling, copyright, emotion, collection, breakthrough, interesting, res ponse, welcome, kappaelastin, science, scientific, johnson, herbert, kappaelastin, spertus, institut e, gallery, national, phoenix, botanical, gardens, aquariums, planetariums, antiquities |
artcom.com - rank der domain 790559 (0 in US)
|
|
| zum Seitenanfang ↑ |
| Artcyclopedia |
| Art cyclopedia: The Fine Art Search Engine |
| http://www.artcyclopedia.com/ |
| Guide to museum-quality art on the Internet. Search hundreds of art museum sites for exhibits and ar tists. |
| The Artcyclopedia is an index of online museums and image archives: find where the works of over 8,0 00 different fine artists can be viewed online. |
| fine art encyclopedia fine art encyclopedia museum exhibit museum exhibit art galleries art gallerie s art museum art museum art exhibit art exhibit |
| renaissance, realism, artcyclopedia, artists, school, mannerism, impressionism, expressionism, copyr ight, search, artists, regionalism, raphaelites, precisionism, northern, social, surrealism, symboli sm, sensation, rococo, romanticism, pointillism, orientalism, hudson, resources, harlem, gothic, gal leries, minimalism, plasticism, tonalism, neoclassicism, advertise, photorealism, compilation, artic les, information, protected, unique, masterpieces, worldwide, museums, worldwide, supplies, artcyclo pedia, comprehensive, project, latest, listings, privacy, policy |
artcyclopedia.com - rank der domain 82156 (31050 in US)
|
|
| zum Seitenanfang ↑ |
| Artnet.com |
| artnet - The Art World Online |
| http://www.artnet.com/ |
| An arts portal, with artist listing, galleries, and auctions. |
| Buy, sell, and research Fine & Decorative Art online.
artnet features international galleries, ar tists and artworks, the largest database of Fine Art auction results & images, and the art world's l eading online magazine. |
| |
| online, artnet |
artnet.com - rank der domain 15274 (5723 in US)
|
|
| zum Seitenanfang ↑ |
| EServer |
| |
| http://eserver.org/ |
| A member-run cooperative that publishes over twenty thousand works, as well as providing directories covering the arts and humanities. |
| |
| |
| |
eserver.org - rank der domain 86876 (31588 in US)
|
|
| zum Seitenanfang ↑ |
| Notebook Directories |
| Notebook |
| http://www.noteaccess.com/DIRECTORIES/index.htm |
| A hierarchical list of arts resources and links sorted by field and subject. |
| Art Directories, References and Resources. The Notebook develops a context for understanding visual arts experience through broad areas of consideration, which include Dimensions, Approaches, Relatio nships, Modes, Themes & Topics, Materials & Methods, Disciplines, Courses, and there are Directories to valuable resources on the web. |
| Art, Exhibitions, Directory, Guide, Artist Opportunities, Artist Resources, Architecture, Design, De corative Arts, Collections, Art Exhibitions, MediaProjects, Art Events, Publications, Regional and L ocal Guides, Resources and Opportunities, Art Education, Art Research, Documents. |
| |
| (SLD : noteaccess.com) |
|
| zum Seitenanfang ↑ |
| Arts/Directories |
|
|
| Arts/Directories |
| zum Seitenanfang ↑ |
| ArtSeek |
| Wassmann Fine Arts Studio | Laguna Beach California |
| http://artseek.com/ |
| Art resource directory with listings of artists, galleries, museums, arts, news, and Internet resour ces. |
| Painter and photographer Cliff Wassmann, located in Laguna Beach, California - Also featuring other Laguna Beach artists |
| Art, Artists, Art Galleries,Art Resources,Laguna Beach,Laguna Artists,Laguna painting,Dana Point pic tures,Monarch beach,Photos,photo,pictures,photo-realism,realism,20th century art,american artsits,An tarctica paintings,antarctica,coast,surf,water,paintings,artists of,art of,sunsets,penguins,iceberg paintings,san juan capistrano,California,californian artists,sawdust festival,festival of arts,Lagun a art festivals,portrait photography,photographers laguna,models,family,sawdust art festival |
| images, california, photography, available, paintings, wassmann, laguna, collections, include, photo graphy, murals, exhibitions, direct, please, search, antarctica, gallery, pictures, emphasis, newpor t, cities, various, prints, capistrano, county, southern, greece, mexico, easter, photos, island, qu ality, international, orange, locations, photographers, unlike, processing, parties, events, county, orange, powered, lightbox, software, artists, laguna, rights, reserved, worldwide, festivals |
| (SLD : artseek.com) |
|
| zum Seitenanfang ↑ |
| The Designers Network |
| Design Sites & Design Jobs - The Designers Network - Design Directory |
| http://www.designers-network.com/ |
| Resource site with directory of artists and designers. |
| '. The Designers Network is a creative design community website and directory of design sites featur ing mainly graphic designers and web designers worldwide. |
| 'design sites, design jobs, graphic design, designer sites, directory, artists, illustrators, educat ion & design training, interior design, photography, reprographics, printers, typography, design vacancies, web design |
| content, design, endcap, 333333, google, friendconnect, ffffff, secondary, container, location, 0000 cc, canvas, directory, designers, border, setparenturl, 7777cc, 15727773545038191944, 666666, design , bbee66, headline, alternate, comment, designer, network, industrial, document, freelance, experien ced, gajshost, massimo, graphic, pagetracker, 000000, designersgraphic, designresourcesweb, training fashion, portfolioseducation, designmedia, designindustrial, designphotographyproduct, communitydesi gner, newdesignjobs, designinterior, 5373342479274602989, renderopensocialgadget, gadgets, illustrat orsarts, e6e6e6, artists |
designers-network.com - rank der domain 420274 (169551 in US)
|
|
| zum Seitenanfang ↑ |
| The Digital Artist |
| The Digital Artist |
| http://www.thedigitalartist.com/ |
| Worldwide online gallery for artists, designers and artisans, with exhibits, daily news updates, boo kstore, articles, and free newsletters. |
| |
| |
| digital, artist, button, workshops, posted, author, comments, gallery, pentleton, watercolors, desig n, calligraphy, portfolio, drawing, thedigitalartist3, charcoal, border, newsletter, techniques, gla zing, design, painting, player, videos, acrylic, default, plugins, canvas, content, pottery, cookie, plugin, emergency, upload, closed, creating, tutorials, sculpture, started, mixing, activity, prepa ring, glazing, component, graphic, swfupload, armatures, technique, radius, getting, ingredients |
| (SLD : thedigitalartist.com) |
|
| zum Seitenanfang ↑ |
| Performing Arts and Artists Worldwide |
| Performing Arts & Artists Worldwide |
| http://www.paaw.com/ |
| A developing worldwide directory of official sites of the arts, performing arts, film, and music ind ustry, and all aspects of official production related sites. |
| Performing Arts Artists directory indexing official web sites of the Performing Arts and Artists&quo t; |
| Performing Arts directory, Performing Artists directory, directory of Performing Artists, Performi ng Arts portal Performing Artists portal |
| directory, prophecy, performing, macbeth, advertise, wsmacbeth, yearly, worldwide, artists, resumes, another, lindsey, working, shakespeare, forgot, against, resources, column, directories, remember, visiting, username, password, auditions, portal, croatianczechdanishdutchestonianfilipinofinnishfren chgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuan ianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanis hswahiliswedishthaiturkishukrainianvietnamesewelshyiddish, christ, traditional, chinese, translate, readyadvertise, select, languageenglishafrikaansalbanianarabicbelarusianbulgariancatalanchinese, sim plified, religion, oncalendar, himself, theory, written, william, original, edited, version, entity, rights, reserved, copyright, uscontact, homeabout, hecate, paawpaaw |
paaw.com - rank der domain 923813 (0 in US)
|
|
| zum Seitenanfang ↑ |
| Kara Art |
| davis kara xara 50 cent at karaart.com |
| http://karaart.com/ |
| Features twelve sections dedicated to the visual arts: artists, galleries, ceramics, prints, museums , collections, contests, books, aboriginal art, outsider art, photography, and paintings by P.P.Paso lini. |
| davis kara xara 50 cent bingo book cd duplication r |
| davis,kara,xara,50,cent,bingo,book,cd,duplication,r |
| return, xmlhttp, pagetracker, function, document, gajshost, getippi, activexobject, xmlhttp, karaart , createxmlhttprequest, gettracker, 2249740, trackpageview, initdata, 8bea71fb, xmlhttprequest, a118 7e62d51a, microsoft, msxml2, script, centbingobookcd, daviskaraxara50, searches, duplicationcd, rcha tcompetitiondj, moviedvd, dvddvd, equipment, related, welcome, playerfilm, downloadflying, analytics , google, javascript, 3cscript, unescape, protocol, location, lessonfootball |
| (SLD : karaart.com) |
|
| zum Seitenanfang ↑ |
| Zeroland |
| Arts and Artists on the Web: The Worldwide Arts Portal and Arts Directory |
| http://www.zeroland.co.nz/ |
| An international directory of selected arts web resources including literary e-texts, classical musi c midi files and art images. |
| Worldwide arts websites; arts on the internet, the arts directory |
| art, the arts directory, art for sale, artists, arts hub, contemporary art, arts search engine, craf ts, arts directory, fine arts,arts culture, arts portal,literature onlinw, film online, film directo rs, philosophy, art history, art periods, photography, fashion, performing arts, theatre, art museum s and galleries, art by country. |
| cinema, cinema, artists, museums, periods, american, webpages, allposters, posters, websites, should , artists, search, organizations, movements, everything, galleries, longer, translate, portal, becau se, google, visual, director, around, french, philosophie, auctions, fashion, musica, filosofia, dir ectory, databases, urchintracker, alfred, renoir, theater, sitting, matter, forget, polanski, pieces , scorsese, martin, breaks, correct, 254172, straight, fiction, bergman, twilight |
| (SLD : co.nz) |
|
| zum Seitenanfang ↑ |
| World Artist Directory |
| The World Artist Directory - Accomplished Artists Worldwide |
| http://worldartistdirectory.com/ |
| Artists' search engine, art news, the Art Teacher, and the Real-time Art Critique Gallery. |
| The net's source for accomplished artists worldwide. Also see the Art Critique Gallery and Forums, w orld art news and articles, artist funding, the Art Teacher, Art Kids Rule!, and much more.. |
| art, arts, artists, crafts, artists, fine art services, art education, dance, music, theater, sculpt ure, ceramics, art competitions, art contests, call for entries, writing contests, call for entries, juried exhibitions, artist registry, index |
| artist, artists, artists, accomplished, access, directory, opportunities, exhibition, search, databa se, income, worldwide, network, opportunities, income, create, artdeadline, connect, participate, ev ents, artist, deutsch, keywords, francais, english, italiano, espanol, source, community, applicatio n, america, source, accomplished, exhibit, gallery, dedicated, newsletter, information, distribution , marketing, articles, quality, helpful, magazine, possibilities, receive, contemporary, support, fi nest, almost, assured |
worldartistdirectory.com - rank der domain 958272 (0 in US)
|
|
| zum Seitenanfang ↑ |
| Artsofar |
| artsofar |
| http://www.artsofar.com/ |
| A portal for the discerning lover of the arts. |
| artsofar: the leading art portal for the discerning lover of the arts |
| artsofar, australian, art, contemporary, landscape, abstract, painting, sculpture, photography, comm ent, opinion, reviews, gallery, galleries, magazine, services, consultancy |
| artsofar, artists, festival, childhood, sunday, exhibition, carlisle, contemporary, stkildafestival, health, electronic, invitations, hardcopy, featured, listing, fitted, maximum, medium, commission, provided, provide, printed, vineyard, enquiries, opening, please, hotmail, mariella, website, progra m, voluntary, phillip, almanac, dedicated, contribution, towards, requested, exhibition, amount, sug gested, opening, drinks, trevor, hoppen, granville, richard, january, dateline, morrissey, michelang elo, fitzgerald |
| (SLD : artsofar.com) |
|
| zum Seitenanfang ↑ |
| Rootster |
| Rootster: a search for culture |
| http://www.rootster.com/ |
| A small, edited database of articles and links to music, art and cultural information. Associated wi th the online magazines RootsWorld and Hollow Ear. |
| Search for culture on the web |
| world music, roots, folk, |
| rootster, planet, culture, record, galileo, featured, rootsworld, advertisement, search, review, gal ileo, twelve, material, between, recorded, actually, logical, northern, before, recording, months, t hessaloniki, planetary, choice, changing, editors, recomended, global, interesting, database, edited , search, images, submit, accordion, raices, cubanas, trinidad, tobago, online, poetry, culture, glo bal |
rootster.com - rank der domain 996020 (414603 in US)
|
|
| zum Seitenanfang ↑ |
| Art Channel |
| ART CHANNEL - World Wide Art Network |
| http://www.art4net.com/ |
| Network of artists, museums, galleries and other resources. |
| ART CHANNEL - Art Exhibitions, Art Museums, Art Galleries, Art News, Artworks, Photography, Movie, M usic, Fashion, Books, Poetry, Channels & Resources |
| art channel, art, channel, network, museums, exhibitions, links, shop, ballet, photo, poetry, music, movies, fashion, galleries, photography, worldwide, sculpture, server, resources, posters, prints, pictures, images, frames, expressionism, impressionism, paintings, artwork, Goya, Matisse, Monet, Mo digliani, Munch, Picasso, Pollock, Rembrandt, Rubens, Rodin, Schiele, van Gogh, Waterhouse, Warhol |
| network, channel |
| (SLD : art4net.com) |
|
| zum Seitenanfang ↑ |
| Oriscus: |
| Oriscus.com: The Arts & Culture, Technology, Meaning |
| http://www.oriscus.com |
| "The Arts, Technology and Meaning." Internet resources in the arts, technology, music, musical instr uments and philosophy. |
| Resources relating to musical instruments, arts and technology mangement, music and spirit, and the arts and culture of Kentucky. |
| musical instrument information, musical instruments, arts, management, technology, web development, Kentucky, Dwight Newton |
| oriscus, border, nation, please, oriscus, content, newton, domain, websites, problems, viewing, cult ure, standards, current, better, disclaimer, supports, browser, outside, unless, otherwise, 346370, urchintracker, privacy, statement, website, contents, suggestions, comments, quality, leftcontent, d wight, philosophy, resume, bypass, summary, interests, display, instruments, musical, welcome, navig ation, bypass, dedicated, culture, technology, rightcontent, resources, internet, development, distr action |
| (SLD : oriscus.com) |
|
| zum Seitenanfang ↑ |
| EURAN European Art Network |
| EURAN European Art Networks News Channels |
| http://www.euran.com/ |
| Web directory of art-related sites. |
| The Euran, European Art Networks Home Page. Culture (architecture, art, fashion, industrial design, photography, television) and business channels. <meta http-equiv= |
| Euran, European Art Networks, Culture and business, Architecture, Art, Fashion, Design, Photography, Cultural television |
| security, partition, d5f86d3b, 1248774, urchintracker, invisible, remove, style1, medium, channels, networks, style2, project, european, 2222952 |
| (SLD : euran.com) |
|
| zum Seitenanfang ↑ |
| ArtBoomer.com |
| ArtBoomer.com - World's Premier Art Portal, Global Directory & Gallery |
| http://www.artboomer.com/ |
| Offers global art resources. A directory of artists and art professionals, as well as a visual means to enhance global exposure. |
| World's premier art portal presents international visual and performing arts. Features online art ga llery and directory, online auction, contemporary art links and more |
| Premier Art Portal,International Art Directory,Fine Art Gallery,online art gallery,Contemporary Art, acrylics painting,Oil Painting,Oil Paintings,Art Auction,online auction,auction system,art community forum,Fine Art,Web Design,Visual Art,Visual Arts,Performing Art,Performing Arts,Clip Art,Virtual St orefront,Artist Portfolio,online portfolio,Animation,Art Seller,Art Sellers,Art Work |
| listing, register, category, portal, artists, global, online, marketplace, shopping, artboomer, mybo omer, directory, solution, galleries, individual, commerce, welcome, premier, worldwide, workshops, festivals, selling, artwork, groups, simple, network, community, exposure, making, limits, without, explore, difference, enhanced, benefits, present, exhibitions, committed, talents, capabilities, dis cover, partners, business, individuals, directory, registration, offers, resources, profiles, enquir ies, search |
| (SLD : artboomer.com) |
|
| zum Seitenanfang ↑ |
| d'Art |
| Fine-Art.com: Marketplace and community for fine art. |
| http://www.fine-art.com/ |
| Directory and database also includes artists' galleries, community, and research fora. |
| |
| |
| family, helvetica, decoration, height, 666666, family, ffffef, padding, cc3400, aorangepad, decorati on, underline, ffcc00, aalphabet, visited, ffce00, active, anewsmu, community, marketplace, margin, special, marroon, result, style13, anew10, ff9900 |
fine-art.com - rank der domain 263850 (105693 in US)
|
|
| zum Seitenanfang ↑ |
| Art Search |
| ART SEARCH - Art Directory: Fine Art listings - popular art sites - artists. New Art JOBS - Search Arts: galleries, museums, theaters .us |
| http://www.artsearch.us/ |
| Searchable visual art, music, and theater directory. |
| Search for your favorite art and artists, rate listed websites. Art galleries, museums, artists, lit erature, magazines, music, new art jobs! Add URL to artists directory. Are you an artist? Submit you r site, show your artwork! US Jobs |
| art, search, add, url, galleries, artist, gallery, artists, add url, submit, site, listed, link, web site, fine, advertise, magazines, music, paintings, drawings, free, web |
| search, directory, window, related, director, search, artists, galleries, artists, advertise, sideba r, setattribute, assistant, university, magazines, college, theaters, contemporary, museums, service s, paintings, drawings, america, creative, action, submit, instructor, theater, europe, listed, perm anent, brooklyn, listings, morehead, document, position, galleries, manager, development, design, po sition, professor, northeastern, artistic, administrative, permanent, receptionist, butler, indianap olis, jordan, general |
artsearch.us - rank der domain 545512 (198289 in US)
|
|
| zum Seitenanfang ↑ |
| Art Source |
| TheArtSource.Com invites the art world to the Internet through free artist and gallery listings. Exhibit your art gallery or portfolio on TheArtSource.Com for free, browse and search for art, artists and galleries, or tap the knowledge of the entire art community. The world is waiting...
TheArtSource.Com is offering free Internet art listings to qualified original artists and galleries for a limited time, welcoming applications from painters, photographers, sculptors, and all other artists. Artists, art galleries and art associations will benefit from our vast community of resources and extensive marketing efforts. Featuring an intelligent search engine, art chats and discussions, links and more, TheArtSource.Com is striving to develop the most comprehensive community of resources for the art industry. |
| http://www.theartsource.com/ |
| Search by artist, gallery or genre. |
| Showcase your artwork to the world by exhibiting your portfolio or gallery on TheArtSource.Com for f ree and our intelligent search engines will escort the art community to you. The world is waiting.. . |
| Art, art, artists, artist, Artist, Artists, Artisans, Artwork, art gallery, art galleries, fine arts , Online, art search, search engine, gallery, galleries, original, museums, original art, art chat, original artwork, free art listings, online exhibits, paintings, painters, sculpture, lithographs, acrylic, oil, bronze, wood, furniture, jewelry, antiques, free, art website design, art marketing, a rtist marketing, art gallery marketing, art associations, children's art, graphics, illustrations, m ixed-media, multimedia, photography, abstract, african-american, americana, animal picture, antiquit ies, art deco, art nouveau, computer, conceptual, contemporary, corporate, cubism, cultural, environ mental, expressionism, fantasy, film, figurative, floral, folk, functional art, Futurism, Gothic, Hi storical, Impressionism, Islamic, Judaica, landscape, marine artifacts, military, miniatures, minima l, modern, mosaic, Native American, nautical, Oriental, outsider, photography, photorealism, pop, po rtrait, poster, post Imp |
| theartsource, artists, breckenridge, communications, community, galleries, gallery, resources, artis ts, artist, listings, search, internet, artworks, members, contact, search, galleries, design, denve r, navigate, lodging, allposters, prints, posters, information, reserved, rights, trademarks, servic e, breckcomm, contact, please, services, dealers, advertising, claims, listing, agencies, agreement, copyright, member, completed, difficult, responsible, 362745, painters, photographers, applications , welcoming, sculptors |
| (SLD : theartsource.com) |
|
| zum Seitenanfang ↑ |
| art in context |
| Art in Context - Index |
| http://www.artincontext.org/ |
| Online reference library for information about artists, museums and galleries. |
| Welcome to the Art in Context web site. Since 1995, Art in Context Center for Communications, a
publicly supported nonprofit organization, has maintained this site as an online re ference library for the publication and dissemination of information about artists and where to find their work. |
| Museums, Galleries and Dealers, Artists, Current Exhibitions, Images, Architecture, Ceramics, Design , Drawing, Film, Installation, Mixed Media, Multiples, Painting, Performance, Photography, Sculpture , Textile, Video, international arts, arts research, visual arts, |
| context, center, university, carnegie, document, public, access, gajshost, technology, communication s, management, mellon, artists, pagetracker, rights, reserved, photography, prints, painting, associ ation, college, council, library, research, libraries, explore, drawing, trackpageview, 3cscript, un escape, script, google, analytics, javascript, gettracker, location, 1420157, protocol, hosted, libr ary, release, introduce, pleased, database, infrastructure, expand, presentation, significantly, enh ancements, powered, museums |
artincontext.org - rank der domain 967941 (407726 in US)
|
|
| zum Seitenanfang ↑ |
| Artfacts.Net |
| Artfacts.Net - the international gallery guide for modern, contemporary and emerging art |
| http://www.artfacts.net/ |
| International online gallery and museum guide for modern, contemporary and emerging art. |
| Artfacts.Net - the international gallery guide for modern, contemporary and emerging art |
| Artfacts.Net - the international gallery guide for modern, contemporary and emerging art |
| 2034470246393760, googleaddslot, banner, artfacts, language, medium, lightbox, selector, exhibitions 263, bodensee, remaining, artesantander, biennials, verstehen, welten, worlds, mapping, exhibitions, trails, safdie, ronnen, andrea, meislin, gallery, michal, services, artwork, artwork, deutsch, ntil de, english, googlefetchads, gallery, international, modern, googleenableallservices, googleaddadsen seservice, emerging, contemporary, ccedil, search, artistsexhibitionsinstitutions, artists, exhibiti ons, welcome, institutions, contact, products, italiano, shortlinks, fairs922 |
artfacts.net - rank der domain 136366 (51101 in US)
|
|
| zum Seitenanfang ↑ |
| Artists Domain |
| YourArt.com - Web Services For Artists World-Wide |
| http://www.yourart.com/ |
| Directory of artists and virtual galleries. |
| |
| |
| gallery, galleries, virtual, directory, yourart, health, sports, commercial, artist, websites, extre me, services, artists, autism, horses, cancer, bridal, webwinkel, vanmaria, motivational, egaswelkom , developments, copyright, paintings, casselcasselweb, ettinger, kubatbogdan, wildlife, barcelonacon trast, laducaandrea, stubbsaustralian, fitingereleanor, prince, recent, artstudio, meislin, scrubyhe roic, gallerybrian, featured, realism, graphite, contact, donations, signup, search, watercolor, sig nup, geetfine, davisturner, raganfine, bakerscott |
yourart.com - rank der domain 948106 (389889 in US)
|
|
| zum Seitenanfang ↑ |
| Florida Artists Registry |
| Florida Artists Directory and Portfolios of artwork on Florida Artists Registry.com. Florida Artwork, Artists, Art Galleries, Art Museums and Art Centers. |
| http://www.floridaartistsregistry.com/ |
| Statewide directory of artists, galleries, museums and art organizations, offering free site submiss ions. Calendar of art events, links. |
| Artwork by Florida Artists with International Exposure. Graffiti Art, Drawings, Paintings, Watercolo rs, Photography, Sculptures in Bronze, Wood, Steel and Mixed Media. Art Message Board with Gallery E vents and Openings |
| art, artists, galleries, florida art, orlando sculptors, fine art, art museums, art gallery, art cen ters, paintings, drawings, sculpture, prints, portfolios, museums, artistic, baroque, black and whit e, bronze, canvas, ceramics, contemporary art, cubism, drawings, expressionism, fiber arts, folk art , graffiti, new york grafitti, street art, gifts, granite, keith haring, metal, mixed media, oil, ou tsider art, sculptors, paper, pastel, photos, photographs, photography, pop art, realism, realistic, religious, roman, watercolors |
| florida, artwork, artists, registry, contact, listing, information, artists, members, medium, premiu m, organizations, portfolio, museums, galleries, members, images, portfolios, receive, through, incl uding, change, personal, control, inforamtion, special, become, recognition, newseltter, message, ar tist, exhibit, portfolios, membership, artwork, include, address, update, ranking, immediately, when ever, benefits, artistsregistry, member, weekly, provides, galleries, museums, worldwide, taking, cr eating |
| (SLD : floridaartistsregistry.com) |
|
| zum Seitenanfang ↑ |
| Multitalented.com |
| Welcome to www.MULTITALENTED.com! |
| http://www.multitalented.com/ |
| Searchable business directory for visual and performance artists. |
| WWW.MULTITALENTED.COM is the premier place to find talent for hire. An artist community within the s ite is also a welcome place to show off art! |
| multitalented,talent for hire,talent,art,music,bands for hire,musicians,music,jugglers,portrait arti sts,DJs,DJ's,clowns,singing telegrams,dancers,actors,soloists,pianists,harpists,guitarists,bands ,singers,freak shows,web design,characatures,talented |
| search, sitemap, search, search, reserved, rights, please, helping, contact, children, listing, abus ed, duplication, talent, bcentral, welcome, multitalented, fastcounter, updated, multitalented, cont ents, permitted |
| (SLD : multitalented.com) |
|
| zum Seitenanfang ↑ |
| Working Cowboy |
| WorkingCowboy.com, Your Country, Cowboy and Western Connection |
| http://www.workingcowboy.com |
| Classified ads and a directory of links. Supplemented with information on Western arts, crafts and m usic. |
| WorkingCowboy.com, Your site for all things Country, Cowboy and western. From western music to cowbo y events and festivals. Cowboy craftsmen and where to find them. Western and cowboy artists,
perfor mers, western movie celebrities, John Wayne, Ben Johnson, Buck Taylor and more. Bit and spur makers, Cowboy Artists of America, Cowboy Cartoonists of America, Saddle makers,
Academy of Western Arti sts, Radio station playlists, Music Charts. Upcoming cowboy and Western Film Festivals all over the world listed.
Listings from A to Z in country, cowboy and western information |
| workingcowboy.com, western art, shopping, shopping online, cowboyboots, cowboy dallas, history music western, country music, cowboy art, links, working cowboy, cowboys, western swing music,
western m usic, cowboy music, tack shops, custom tack, western art, cowboy poetry, trade links, cattle ranches , horse ranches, horses for sale, western collectibles, cowboy collectibles, TV westerns,
Western M ovies, John Wayne, Dean Smith, National Cowboy and Western Heritage Museum, Sam Elliott, Buck Taylor , Denny Miller, Ray Price, Legends of Western Swing Festival, Bobby G. Cargill,
Linda Kirkpatrick, Dennis Gaines, Ken Overcast, Billy Mata, MYSPACE, Google, Stephen Pride, Double H Agency, The Famous Lucille, giddiupgo, Donnie Blanz |
| website, workingcowboy, urchintracker, 2876875, country, workingcowboy, cowboy, welcome, connection, western |
| (SLD : workingcowboy.com) |
|
| zum Seitenanfang ↑ |
| Art and Technology at About.com |
| About.com Painting -- Learn How to Paint, Painting Tips, Creativity |
| http://painting.about.com/ |
| Multi-disciplined arts arena with links and features. |
| All about painting and learning how to paint. Whether you're into painting with oils, acrylics, wate rcolors, pastels, or mixed media, here you'll find essential how-to information, tips, painting proj ects, and articles on painting-related topics. There's also plenty for anyone who enjoys face painti ng, fabric painting, decorative painting, stenciling, or one of the many other types of painting. |
| painting, how to paint, watercolors, acrylics, oil painting, pastels, digital painting, decorative p ainting, murals, egg tempera, encaustic, stenciling, fabric, mixed media, inspiration, creativity, p rojects, color theory, figure, art materials, stores, magazines, career development, quotes |
| painting, margin, decoration, test20, painting, adunit, padding, function, widgets, colors, useful, watercolor, certain, having, painters, really, personal, preference, together, answer, painting31, m oremore, poetrywhere, machineget, ideaspainting, frisket, remover, todayjuly, project, colors, trans portphoto, challenge, reflectionszobr, masking, particular, object, rubbery, something, escaped, ver sion, larger, different, angles, friday, figures, photosmore, figuresproportions, moresee, certainly , facepainting, spotlight10 |
about.com - rank der domain 82 (42 in US)
|
|
| zum Seitenanfang ↑ |
| Arts Policy and Management, City University |
| Links - City University London |
| http://www.city.ac.uk/cpm/res_collection/useful_links.html |
| Extensive links covering all areas of arts, museums, galleries and heritage policy and management |
| main links pages |
| e-magazines, arts, cultural policy |
| organisations, contact, useful, centre, global, earlier, pagetracker, provide, accessibility, organi sation, forward, please, contact, librarian, kimresource, function, remove, breadcrumb, nositemap, s etdomainname, trackpageview, includes, welcome, document, length, sitemap, reports, students, naviga tion, content, alumni, default, search, search, contrast, dyslexia, london, university, viewed, city 2col, import, articles, resource, additions, considered, magazines, newspaper, various, research, ne tworks, studies |
| (SLD : ac.uk) |
|
| zum Seitenanfang ↑ |
| International Registry of Artists and Artwork |
| International Registry of Artists and Artwork (IRAA) |
| http://www.artseditor.com/iraa/ |
| IRAA members search engine and forum. |
| |
| |
| artwork, international, registry, artists |
| (SLD : artseditor.com) |
|
| zum Seitenanfang ↑ |
| World Gallery and Museum Guide |
| Albright-Knox Art Gallery |
| http://www.albrightknox.org/resourcecenter |
| Collection of links to art museums, galleries, libraries, art-related publications, and digital/new media web sites provided by Albright Knox Art Gallery. |
| |
| albright, knox, art, museum, gallery, collection, search |
| browser, capable, frames, displaying, requires, albright, gallery, viewing |
albrightknox.org - rank der domain 967735 (398256 in US)
|
|
| zum Seitenanfang ↑ |
| Contact A Creative |
| Illustrators, Photographers, Illustration, Photography, Source Books and Online Portfolios |
| http://www.contactacreative.com/ |
| An online directory of creative services, including photographers, illustrators, designers and other services. |
| Contact publish source books and online portfolios advertising photographers and illustrators. For o ver 25 years we have produced one of the UK's leading, most influential and recogniseable source boo ks. |
| illustrator, illustration, illustrators, photographer, photography, photographers, uk illustration, uk illustrators, uk photography, uk photographers, e-book, source book, comission, royalty free |
| illustrators, photographers, search, illustration, select, pagetracker, photography, creatives, plea se, online, service, imagery, gajshost, document, featured, contact, artists, source, outdoor, deele n, copyright, conditions, lightbox, sports, signup, contributor, support, photographic, garlick, fea tured, fantasy, keyworded, activities, spotlightian, services, clicking, contributors, spotlightfred , libraries, javascript, script, initdata, trackpageview, 3910844, gettracker, analytics, google, po rtfolios, online, location, popular |
| (SLD : contactacreative.com) |
|
| zum Seitenanfang ↑ |
| ArtWebLinks.com |
| ArtWebLinks.com - Directory of artists, art suppliers, art galleries and other art related resources |
| http://www.artweblinks.com/ |
| A searchable directory of artists, galleries and other art related websites from around the world. |
| A searchable directory of artists, galleries and other art related websites from around the world. E ntries are organised by category and show an example of the artists work. |
| art, artists, art galleries, art suppliers, art resources, paintings, sculptures, ceramics, seascape s, woodturning, art directory |
| suggest, woodturning, directory, directory, artists, photography, category, arlott, artweblinks, scu lpture, cornish, including, yvonne, artistic, category, design, directories, limited, artistic, syst ems, artists, galleries, painting, related, galleries, photographic, equipment, textile, marketing, mounting, services, framing, airbrush, screenprinting, portals, alphabetical, contact, newsletters, resources, general, copyright, privacy, planet, website, rights, reserved, queries, execution, power ed, script, suppliers |
artweblinks.com - rank der domain 586873 (220636 in US)
|
|
| zum Seitenanfang ↑ |
| YourArtsLinks.com |
| Free Directory of Art and Artist Listings, Gallery News Articles |
| http://yourartlinks.com/ |
| Directory includes artists, museums, galleries, education and workshops. |
| International Directory of Art and Artists. Free listings, art marketing news and tools. Royalty pub lishing, online galleries and free art classifieds. |
| |
| articles, marketing, galleries, listings, categories, online, printmaking, supplies, artists, public ations, brokers, dealers, instruction, username, password, enhanced, categories, schools, publishers , workshops, account, mailing, joinour, directory, forgot, register, message, preferred, printer, gi clee, staples, registered, winner, popular, editors, article, advertising, search, classifieds, frie nd, advanced, phrase, artist, gallery |
yourartlinks.com - rank der domain 959183 (336577 in US)
|
|
| zum Seitenanfang ↑ |
| The Fanlistings |
| The Fanlistings |
| http://www.thefanlistings.org/ |
| Official headquarters to join or create sites for favorite celebrities or subjects. Provides details for membership, awards, lists, community, and forum. |
| TheFanlistings.org Headquarters. Come and show that you're a fan too! |
| entertainment, actress, actor, hollywood, sports, movies, web directory, community, fanlisting, thef anlistings.org, the fanlistings, fan, fanlistings, join, fans |
| fanlistings, fanlisting, fanlistings, support, fanlisting, listed, community, category, updates, sta ffer, contact, tickets, people, subject, newbies, syndicate, welcome, explain, report, thefanlisting s, around, function, creating, created, interested, security, warcraft, systems, wholesale, ultimate , jerseys, stubhub, concert, products, tristar, identity, partners, across, subjects, related, uniti ng, dedicated, document, original, directory, really, grateful, fitness, robbie, williams, advertisi ng |
thefanlistings.org - rank der domain 948751 (330031 in US)
|
|
| zum Seitenanfang ↑ |
| AskART.Com |
| |
| http://askart.com/AskART/index.aspx |
| Information on about 52,000 American artists including biographies, bodies of work, valuation and ap praisal techniques, auction records, publications, and artists representatives, as well as literatur e and museum information for american painters and sculptors. |
| |
| |
| document, frmsearch, action, askart, submitbutton, buttonid, indexof, artist, artists, string, artis ts, directory, auction, getelementbyid, replace, submitartistbutton, auction, action, function, cont ains, notable, scarlett, dealers, prices, artist, services, studio, create, museums, keycode, append , return, executed, navigator, append, appname, string, netscape, modernists, appraisals, sculptors, school, hudson, topics, subscriptions, advertise, searched, impressionists, highest, impressed, mus eum |
askart.com - rank der domain 60101 (23311 in US)
|
|
| zum Seitenanfang ↑ |
| Art Offer |
| Art Offer – Der Kontakt zur Kunst |
| http://www.artoffer.com/ |
| Directory and search engine of artists, galleries and exhibitions. In English and German. |
| |
| |
| kontakt |
artoffer.com - rank der domain 391858 (24140 in DE)
|
|
| zum Seitenanfang ↑ |
| Intute: Arts and Humanities |
| Intute - Home |
| http://www.intute.ac.uk/artsandhumanities/ |
| A free online service providing you with access to Web resources for education and research, selecte d and evaluated by a network of subject specialists. |
| Intute - Home |
| internet; resource; catalogue |
| sciences, record, studies, intute, comments, resources, research, planning, replies, virtual, intern et, medicine, veterinary, search, training, search, olympic, cookies, future, resource, records, soc ial, humanities, browse, forestry, medicine, science, computer, mathematics, environment, geography, performing, creative, education, methods, agriculture, engineering, communication, subject, archite cture, psychology, midwifery, allied, management, nursing, including, business, languages, modern, h ealth, biological |
| (SLD : ac.uk) |
|
| zum Seitenanfang ↑ |
| Net-Art |
| Art and Photography Search Engine and Directory - Motore di ricerca e directory d'arte e fotografia |
| http://www.net-art.it/search/ |
| Search engine and directory of visual art and photography sites. Also in Italian. |
| Art and Photography Search Engine and Directory - Motore di ricerca e directory d'arte e fotografia |
| art directory, arts search engine, arts, photography, searches, links, listing, index, art sites, di rectory d'arte, fotografia, motore di ricerca per l'arte, ricerche, motori, links, arti, indice, sit i d'arte, elenco |
| directory, 214177, tradedoubler, string, motore, search, document, random, substring, affiliates, si tocchio, 17288008, ricerca, engineand, edirectory, fotografia, engine, photography, ricerca, directo ry, english, photomonitor, addmaster, segnalatore, italiano, powered, siteeye |
net-art.it - rank der domain 406670 (7021 in IT)
|
|
| zum Seitenanfang ↑ |
|
